KEGG   Hippocampus comes (tiger tail seahorse): 109517345Help
Entry
109517345         CDS       T04969                                 

Gene name
abhd12b
Definition
(RefSeq) protein ABHD12B
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     109517345 (abhd12b)
Peptidases [BR:hcq01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   109517345 (abhd12b)
Exosome [BR:hcq04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109517345 (abhd12b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 323 aa AA seqDB search
MKVISFLVLVYVTVPFTIYLCPWILDYAIFAHLLRLPYLVDLNHPEYVLNHTCNFYLDPE
EGVRVGVWHTLPASQWDEAAGRGPDWYRKALGDGSPVIIYLHGNVGTRAKNHRVQLAKIL
SSAGFHVLSLDYRGFGDSTGEPSERGMTTDAFHLYTWVKQHSGGSLVCLWGHSLGSGVAS
NTAVKVQEQGSIVDALILEAPFTNIGEVVVDFPLAKLYTFLPGFELFLWNTLEKNKLIFA
NEDNLKVLTCPLLILHAEDDDMVPYSMGQKLYQISLRTHRERSKEVPLKMISYPATRGFS
HNDIYLDPDLATSVGDFLQKLRG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaatatccttcctggtgcttgtctatgtgacagtgccattcaccatctacctg
tgcccttggatactggattatgccatttttgctcacttgctgaggcttccatatttggtg
gatctcaaccatccagaatacgtgcttaaccacacgtgcaacttctacctggacccggag
gagggcgtccgtgtgggtgtatggcacacgctccctgccagccaatgggatgaggcggca
gggagaggccccgactggtaccgcaaggctctgggagatggaagtcctgttatcatctat
ctccatggtaacgtgggcaccagggccaaaaatcacagggtgcaactggcaaagatttta
agctccgcagggttccacgtcctgtctttggactacagaggcttcggcgattcgacaggg
gagccgagcgaacgcgggatgaccacagacgccttccacctgtacacatgggtgaagcag
cacagtggggggtctctggtgtgtctgtgggggcactcactcggttccggggttgcgagc
aacaccgccgtaaaggtgcaagagcaaggttccatcgtggacgccttaattctcgaggct
ccgttcacaaatatcggcgaggttgttgtcgactttcctctggctaagctctacacgttc
cttccgggctttgaactcttcctgtggaacactttggagaagaacaagctaatttttgct
aacgaagacaatttaaaggtgctgacctgtccgttgctcattctgcacgcggaggacgac
gacatggttccgtatagcatgggtcaaaagctgtaccagatttcattgcgcacgcacagg
gagcgcagcaaagaagttccgttgaaaatgatctcctacccggcgactcgcggattctcc
cacaatgacatctatttggatcccgacctggccacgtcggtgggcgattttctgcagaag
ctacgagggtag

DBGET integrated database retrieval system