KEGG   Hippocampus comes (tiger tail seahorse): 109523235Help
Entry
109523235         CDS       T04969                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like isoform X1
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     109523235
Peptidases [BR:hcq01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   109523235
Exosome [BR:hcq04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109523235
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 350 aa AA seqDB search
MRQRTHKKEVSTSAQTTAQVQRKHENESRWMKSCLFALFVILLLAPFTLIMSRELFQHLV
YKHRIKVPFFVDLNQPVDFSLNHTINMYLTSEEGISLGVWHTVPESHWREAQGKDLAWYQ
STLSDGNPVFIYLHGNTGTRAATHRVGVAKVLSALGYHVLVPDYRGFGDSSGEPTEVGLT
TDALHVYNWAKERSGSSLVVFWGHSLGTGVSTNTAVKLVEQAGIVLDGVILEGTFNMRNE
KLPFHVFSWYYWKFPGWGYFFPEPWAENKVVFPTEENVKKMKSPLLFLHAEDDSVVLIHS
AQQLYNIAVSAQNAERVKFVTFEGSLGYLHNGLYKDPRLPDIIKKFVLTL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagacaaagaactcataaaaaggaagtgtcaacctccgcgcagacaacagcccaagtt
cagcggaagcacgaaaatgagtcccggtggatgaaaagttgtttatttgcactgtttgtc
atccttcttttggctcccttcaccctgatcatgtcacgagaattattccaacaccttgtt
tacaagcacagaatcaaggttccattctttgttgacctcaaccaacctgttgatttctcc
ctaaatcacaccatcaacatgtacttaacatcagaggaagggatttctcttggtgtatgg
catacagtgcctgagagtcactggagggaggcgcaaggtaaagacttggcatggtaccaa
agcacattaagtgatggaaatccagtatttatatatctacatgggaacacaggcacaagg
gcagcgactcatcgggtgggagttgcaaaagtattgagtgcacttggttaccatgtgttg
gtgcctgactacagaggttttggagactcaagtggtgagccaactgaagttggactcaca
acagatgccctccatgtgtacaactgggccaaagaacgcagcggaagcagcctggtcgtc
ttctggggacattctcttggcactggagtgtccacgaacactgcagtcaaacttgtagaa
caagcaggtattgttttggacggcgtgattctcgaaggcacctttaacatgcgtaatgag
aaactaccatttcatgtgttttcatggtattactggaagtttcctggctggggatatttc
tttccagagccatgggctgaaaataaagttgtctttcccactgaggaaaatgtaaaaaaa
atgaaaagcccactacttttcctgcatgcagaagacgattcagttgttctcatccattct
gctcagcaactgtacaacatagcagtgagtgctcagaatgcagagcgagtcaagtttgtg
acctttgaagggtctttagggtatctacacaatggattatacaaagacccccgtctgcca
gacatcattaaaaagtttgtgttgactttgtga

DBGET integrated database retrieval system