KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0032Help
Entry
HDEF_0032         CDS       T00911                                 

Gene name
recD
Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hde00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HDEF_0032 (recD)
Enzymes [BR:hde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     HDEF_0032 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(30054..31940)
Genome map
AA seq 628 aa AA seqDB search
MMGLLNQALDQKLLRFLDVQFAQIIAAHHSPLLQLACALLSSDAGAGHVCLPLARLAPEY
FFDGRHPELAEALWQAAGKPNKNAWLNAFQSSSLVGEGTSPTPLVLEKERLYLQRMWKNE
GQVIQFISDYSLEKMTYHKKDECRLKQILDQLFTSNESDINFQKVAAAVAITSKVAIISG
GPGTGKTTTVAKLLTALIRLAGERTLRIELAAPTGKAAVRLTQSLGNAYRELSLSAGESR
RLPEKACTLHRLLGAYSKGHQSRYHKNNPLDLDVLVVDEASMVDLPMLARLIDALPNSAQ
VIFLGDRDQLASVEAGSVLGEIGRFLSLGYSTSRAEELNRLTGYDLKGHPIEHFPNLCVA
HVCDQLCLLNKNYRFDKKSGIGELAQAVNSGEHHKAHSILRDVNKKYVDIRQHALSDAKD
YQKLLKDCVAAYQPYLELIKQGKDPETILHAFNRYQLLCALRTGSFGLEGLNTQIEKTLC
HSGLLSLSQKPFNNSWYSGRPIMIECNDSSLGLFNGDLGMTLYDHSGALRVYFQFSDGHI
KSVQPNRLPAHSTAYAMTVHKSQGSEFEHTALVLPDHFTPIVTRELVYTAITRARQKLTL
YSTDKVLNHAILTPTQRRSGLVARLKSF
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgatggggttattaaatcaagccctggatcaaaaattattgcgttttcttgatgtgcaa
tttgcacaaatcattgctgctcatcattcacctttattgcagctcgcttgtgctctattg
agctcagatgccggtgcaggacatgtttgtttacccttagctcgcttagcccctgaatat
ttttttgatggccgtcaccctgaattggctgaagctttatggcaagccgccggaaaacca
aataaaaatgcatggttgaacgcatttcaatcctcctcgctcgtcggtgaaggcacttca
ccaacccctttggtcttggaaaaagaacggctttatttgcaaagaatgtggaaaaatgaa
ggtcaagtgattcaatttatttcagattattctttagaaaaaatgacataccataaaaaa
gatgaatgtcgtctcaagcagatccttgatcaactattcacttcgaatgaatctgatatt
aactttcaaaaagtggcggctgcggtggcgattaccagtaaagtcgccattatttcagga
ggaccagggacaggaaaaaccaccacagtggcgaaattactcaccgccttgatacggctt
gcaggagaacggactttacgtattgaacttgccgcgcccacaggaaaagccgccgtacgt
ttaacacaatcgctaggcaacgcttatcgtgaattatcactgagcgcgggagaatcgcga
cgcttgccagaaaaagcttgtactttgcaccgtttacttggggcttactctaaaggacat
caatctcgttatcataaaaataatccattagatctggatgttttagtcgtggatgaagct
tctatggtggacttgccgatgttggcccgattaattgatgctttacctaactcagcccaa
gtcatcttccttggtgacagagatcaacttgcttcagtagaagcggggtctgtattagga
gaaattgggcgttttttgtctcttggttacagcacatcacgagcggaagaattaaacagg
ctgacaggatatgatttgaaagggcatccaatagaacattttccaaatctctgtgttgct
catgtctgtgatcagctttgtttactcaataaaaattatcgttttgataaaaaatcaggg
ataggtgaactggcgcaagccgttaactcaggtgagcatcataaagcgcactctatttta
agggatgtcaataaaaaatatgttgatatcagacaacatgcactgagtgatgctaaagat
taccaaaaattactgaaagactgcgttgcggcttatcagccctatcttgaactgattaaa
cagggaaaagatcctgaaaccatattacatgctttcaatcgttaccaactgttatgcgca
ctgcgcacgggctcatttggtctagagggtttaaatacacagattgaaaaaactttgtgt
catagtggtttattaagcctatcccaaaaacctttcaataattcatggtattccgggcga
cctatcatgatagagtgcaatgacagttcattagggttatttaatggtgatctgggcatg
actctttatgatcactcgggtgccttaagagtgtattttcaattttcagatggccacata
aaatccgtgcaaccgaatcgtttgccagcgcacagtacggcatacgcgatgaccgttcat
aaatcacaaggatctgaatttgaacacactgcattggtgttgcctgatcattttacccct
atcgtcacccgagaactggtttatacggccatcactcgagctcgtcaaaaattaacgtta
tattccaccgataaagtattgaatcatgcgattctaacccctactcaaagacgaagtggt
ttagttgcacggttaaaatctttttaa

DBGET integrated database retrieval system