KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0040Help
Entry
HDEF_0040         CDS       T00911                                 

Gene name
gnd
Definition
gluconate-6-phosphate dehydrogenase, decarboxylating
Orthology
K00033  
6-phosphogluconate dehydrogenase [EC:1.1.1.44]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
Pentose phosphate pathway
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:hde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HDEF_0040 (gnd)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HDEF_0040 (gnd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    HDEF_0040 (gnd)
Enzymes [BR:hde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     HDEF_0040 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(41121..42533)
Genome map
AA seq 470 aa AA seqDB search
MRKQQIGVIGMAVMGRNLALNIENQGYSVSIFNRSHEKTDQVIEENPEKNLLPCYSLKEL
AESLATPRRILLMVQSGSATDDTIRALTPYLNQGDTLIDGGNSHYQDTIRRSEELLKQGF
YFMGVGVSGGEEGALKGPSIMPGGQKEAYELMAPMFKKIAAKAEGEPCVKYIGPNGAGHY
VKMVHNGIEYGDMQLIAEAYSLLKQGLNLKNFELSDIFKQWNQGELSSYLIEITADIFCK
KDEHGHDLIDFILDEAANKGTGKWTSQSALDLGIPLSLITESVFARYLSSLKTQRIAAAK
VLTGPKIQPFHGQKAEFIEKIRSALYLGKIVSYAQGFQQLQTASEKNDWNLNYGDIASIF
RAGCIIRARFLQKITEAYHQKPNISNLLLAEYFKKIADHYQQALRDIVSYAVQNGIPVPA
FSAAITYYDSYRSALLPANLIQAQRDYFGAHTYKRNDSGQAVFHTNWVTD
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagcaacagataggtgtcataggtatggcggtcatgggccgtaacctggcactt
aatattgaaaaccaaggttattctgtctccatctttaaccgttctcatgaaaaaacagac
caggttatcgaagaaaatccagaaaaaaatctgctcccttgttacagcttaaaagagctt
gcggaatcactggcaacacctcgccggatcctgctgatggtccaatcaggatccgcaaca
gacgacaccattcgcgcactgacgccatatttaaatcaaggagatactttaattgatgga
ggaaacagtcactatcaggacactattcgaagaagtgaagaattattaaaacaagggttt
tatttcatgggggtcggcgtctcaggaggtgaagaaggcgctttaaaaggcccctcgatt
atgccaggggggcaaaaagaagcttatgaattaatggctcctatgttcaaaaaaatcgcc
gcaaaagccgaaggagaaccttgtgtcaagtacatcggcccaaatggtgcaggtcattat
gtaaaaatggtgcataacggcatagaatacggggatatgcaactgattgctgaagcttat
tctttgttaaagcaaggcttaaacctcaaaaattttgagctatcagatatttttaaacaa
tggaatcaaggtgaacttagcagttatcttattgaaataacagcagatattttttgcaaa
aaagatgagcatggccatgatctcatagacttcatcctagatgaggccgccaacaaaggc
acaggtaaatggaccagtcaaagtgctttagatctcggaattcctttaagtctcataaca
gaatccgtatttgcgcgttatttatcctctttaaaaacacaaagaatcgcggcagctaaa
gtactaacagggcccaaaattcagccatttcacgggcaaaaagcagaatttattgaaaaa
atacgatctgctctgtatttaggaaaaatcgtttcttatgcgcaaggatttcaacaacta
caaacagcctctgaaaaaaacgactggaacttaaattacggcgacattgcgagtattttt
cgtgctggctgcattattcgcgctcgatttttacaaaaaataacagaggcttatcatcaa
aaaccaaacatttccaatctgttacttgcagaatatttcaaaaaaattgcggatcattat
cagcaggcattgcgtgatatcgtctcttatgcggtacaaaatggtattcccgttcccgct
ttttctgcggccatcacttactacgacagttatcgctcggcactattaccagctaattta
attcaggctcaaagagattattttggggcacacacttataaacgtaatgacagtggtcag
gcggtctttcatacaaattgggtaaccgattaa

DBGET integrated database retrieval system