KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0041Help
Entry
HDEF_0041         CDS       T00911                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hde00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HDEF_0041 (galU)
   00052 Galactose metabolism
    HDEF_0041 (galU)
   00500 Starch and sucrose metabolism
    HDEF_0041 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HDEF_0041 (galU)
Enzymes [BR:hde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HDEF_0041 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(42595..43488)
Genome map
AA seq 297 aa AA seqDB search
MPQKLKAIIPVAGLGTRMLPATKAIPKEMLPVVDKPIIQYIVNESVLAGVKEIVLVTHSS
KNAIENHFDTSFELEAVLEARVKRQLLQEVQNICPSDVTIMHIRQGQAKGLGHAILCARP
IIGDAPFVILLPDVLLETPSVDCLKENLTCMMERFAETARSQIMVAPIPLEDVCKYGIAD
CGNVIVFPGQAALIKAMIEKPSPKDTPSHLAVVGRYVLSSDIWPLLEKTSPGAGGEIQLT
DAIDMLIETQPVEAFHMTGKWHDCGDKLGYMKAFVEYALRHETEGSAFLNWLKNQNF
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaaaaattaaaagcgattatccctgttgcaggattggggacccgcatgctgcct
gcgaccaaggcgattcccaaagaaatgttacctgtggtggataagcctatcattcaatac
attgtgaatgaatctgtattagcgggggtcaaagaaattgtgctggtcacccattcatca
aaaaatgcgatagaaaatcattttgatacttcttttgaactcgaagcagttttagaggct
cgagtaaaacggcaattattacaagaagtgcaaaatatctgcccatccgatgtcaccatc
atgcacatacgacagggacaggctaaaggactaggacatgccatactctgtgctcgcccc
atcataggggacgccccttttgtcatcctgctaccagatgtactcctggagacaccttct
gtggattgcttaaaagaaaatctcacctgcatgatggaacgctttgcagagacagcgcga
agtcaaattatggtcgcacctattcctctagaagatgtttgtaaatacggtatagctgat
tgtgggaacgtcattgtttttccaggtcaggcggctttgataaaagccatgatagaaaaa
ccttcaccaaaagacaccccctctcatttggccgtggtaggccgttatgttttatcctca
gacatttggcccctactggaaaaaacctcgcccggggcggggggagaaattcaacttacc
gatgccattgatatgttaatagaaacacaacctgtggaagcctttcatatgactgggaaa
tggcatgactgcggcgacaaactaggttatatgaaagcttttgtagagtacgctctgcgt
catgaaacagaaggctccgcatttttaaattggttaaaaaatcaaaatttttaa

DBGET integrated database retrieval system