KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0053Help
Entry
HDEF_0053         CDS       T00911                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HDEF_0053 (tpiA)
   01230 Biosynthesis of amino acids
    HDEF_0053 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HDEF_0053 (tpiA)
   00051 Fructose and mannose metabolism
    HDEF_0053 (tpiA)
   00562 Inositol phosphate metabolism
    HDEF_0053 (tpiA)
Enzymes [BR:hde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HDEF_0053 (tpiA)
Exosome [BR:hde04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HDEF_0053 (tpiA)
  Exosomal proteins of bladder cancer cells
   HDEF_0053 (tpiA)
  Exosomal proteins of melanoma cells
   HDEF_0053 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(55476..56243)
Genome map
AA seq 255 aa AA seqDB search
MRRSLIMGNWKLNGSLSMLAEFITSLSDQIDALKMCDIAIAPPAVYLHEAKKQLKNDRIS
LAAQNVDFNTGGAFTGELSPQMLKEVGAKYVIIGHSERRSYHQETNEGIAKKFALLKETG
LIPVLCIGESETENAQGLTQTICAKQLDAILAKCGPDAFKNSVIAYEPIWAIGTGKAATA
SEAQKVHAFIRQHVSKGKDEIAKTVIIQYGGSVNASNADEFFAEKDIDGALVGGASLKVN
DFLKIAQSAVAAKTF
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgttctttaattatgggaaattggaaattaaacggcagcctttctatgctggct
gaattcatcacaagcttaagcgatcaaatagacgcgttaaaaatgtgtgacattgcgatt
gcgccgccggcggtttacttacatgaagccaaaaaacagcttaagaatgatcgtatttct
ttggccgctcaaaatgtcgattttaataccgggggcgctttcactggtgaactctctcct
cagatgctcaaagaggtcggcgcaaaatacgtcatcattgggcattccgaacgccggagt
taccaccaggaaacgaatgaagggatcgcaaaaaaatttgccttattgaaagaaacgggt
ttgataccggtgctctgtattggcgaatctgaaactgaaaatgcacagggattgacccaa
acaatctgcgcaaaacagcttgatgccatattagcaaaatgtgggccagacgcctttaaa
aactcagtaattgcttatgagcccatttgggcaataggcacaggaaaagcggccacggca
tctgaggcccaaaaagttcatgcgtttattcgccagcatgtctccaaaggaaaagatgag
atcgccaaaacagtgattattcaatatggcggttccgtaaacgcctctaacgccgatgaa
ttttttgctgaaaaagacattgatggagcattggttggtggtgcgtcattaaaagtgaat
gattttttaaaaattgctcagtccgccgtggctgcaaaaacgttttaa

DBGET integrated database retrieval system