KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0087Help
Entry
HDEF_0087         CDS       T00911                                 

Gene name
ahpC
Definition
alkyl hydroperoxide reductase, C22 subunit, thioredoxin-like protein
Orthology
K03386  
peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC:1.11.1.15]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Brite
Enzymes [BR:hde01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     HDEF_0087 (ahpC)
Exosome [BR:hde04147]
 Exosomal proteins
  Proteins found in most exosomes
   HDEF_0087 (ahpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
89527..90150
Genome map
AA seq 207 aa AA seqDB search
MTLVTYIAPDFTAPAVLENGEVTENFNFWSYIKDKPCVLFFWPMDFTFVCPSELIAFHER
NEAFKNRNTKLVGVSLDSHFVHKQWRNTPIEKGGIGKVSYPLVADIKREIQKGYGIEHPE
AGVALRASFLIDENRVIRHQVVNDLPLGRNVDEMLRMVDALAFHQTHGEVCPAQWEEGKS
GMQASSDGVAKYLSEHVSDLKRSSTKS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgactttagtgacttatattgctccggattttacagcacccgccgtattagaaaacgga
gaagtgaccgaaaattttaacttttggtcttatatcaaagataaaccgtgcgttttattt
ttttggccaatggatttcacgtttgtgtgtccttcagaactgattgcttttcatgagcgt
aatgaagcatttaaaaatcgcaatactaaactggtcggggtctctttagattctcatttt
gttcacaagcagtggcgaaacacccccatcgagaaaggcgggattggaaaggtatcttat
cctttggtagccgacataaaaagagagattcaaaaagggtatggcattgagcatccagaa
gccggtgttgctctccgtgcttcgtttttgattgacgaaaatcgagtgatacgccatcag
gttgtcaatgatcttcctctagggcgtaatgtcgatgagatgctgcgcatggttgatgcc
cttgcatttcatcaaactcatggagaggtttgccctgcgcagtgggaagaagggaaatca
ggaatgcaagcttccagtgatggcgtcgcaaaatatctgtctgaacatgtttctgatctc
aaaagatcatcgacaaaatcataa

DBGET integrated database retrieval system