KEGG   Candidatus Hamiltonella defensa: HDEF_0094Help
Entry
HDEF_0094         CDS       T00911                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hde  Candidatus Hamiltonella defensa
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hde01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:hde00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(97158..98300)
Genome map
AA seq 380 aa AA seqDB search
MNHKICPVVMLAQQLIERRSISPEDAGCQDIIAQHLNYFGFTVEPMHFGDTKNLWAWRGS
GEKTLVFVAHTDVVPAGNETLWTTPPFMPSIRDGSLYGRGAADMKGSLAAMIIAAERFVE
AHPNHRQKLAFIITSDEEASGANGTSKVVQALMARNEKVDYSLVGEPSSTERIGDVIKNG
RRGSLTAQLCIQGVQGHVAYPHLAQNPIHQALGALKELSMIEWDQGNAFFPPTSVQITGL
KAGNGVSNLIPDQLHVQFNFRFNTESTYSMIRNQVENLLERYALDYQITWILSGEPFLTP
KGELLDAVLNTVQHYCDSPPDILTTGGTSDGRFIALMGAQVVELGPINQSIHKVNESVSI
ADLQLLTKMYQRIMEQLLLT
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaatcataaaatctgtcctgtcgtgatgttggcacaacaattaattgaacgccgttca
atcagtccagaggatgctggttgccaagacatcatcgctcaacacttaaattatttcggt
tttactgttgaacccatgcattttggtgacacaaaaaatctctgggcctggagaggctcg
ggagagaaaactttggtttttgtggctcataccgatgtggtacctgcgggtaatgaaaca
ttatggacgacgcctccttttatgccatcaatacgtgatggaagtctttatgggagaggt
gccgcagatatgaaagggtctttggcggccatgatcatcgccgctgaacgttttgtcgaa
gcgcatccaaaccatcgccagaaattagcctttattattacctcagacgaagaggcctca
ggcgcaaatggaacttctaaggtcgttcaagctttaatggctcgcaatgaaaaagtggat
tatagcttagtaggggagccttcaagtaccgaacggataggagatgtcattaaaaatggc
aggcgcggctctttaacggcgcaattatgtattcagggtgtacaaggtcacgtggcttat
cctcatttggctcaaaatccgatacatcaagcattaggagctttaaaagaattgtcgatg
attgagtgggatcaaggtaacgcgttttttcctcccacaagcgtgcagataacgggttta
aaagcggggaatggggtgagtaatctgattcctgatcaattgcatgttcaatttaacttt
cgcttcaatactgaatcgacctatagcatgataagaaatcaggttgaaaatttgttagag
cgttatgcgttggattaccaaataacctggatactttccggtgaacctttcttgacaccc
aaaggtgaattgcttgatgcggttctgaatacagttcaacattactgtgatagcccccct
gacattttaaccactgggggcacttctgatgggcgttttatcgcattaatgggagcacag
gtggtggagttagggcctattaatcaaagtatccacaaagtcaatgaatcagtttcgata
gctgatcttcaactattgactaaaatgtatcaacgaattatggaacaattgctcctgacc
tga

DBGET integrated database retrieval system