KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0094Help
Entry
HDEF_0094         CDS       T00911                                 

Gene name
dapE
Definition
(GenBank) N-succinyl-diaminopimelate deacylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00300  Lysine biosynthesis
hde01100  Metabolic pathways
hde01120  Microbial metabolism in diverse environments
hde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hde00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HDEF_0094 (dapE)
Enzymes [BR:hde01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HDEF_0094 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ACQ66869
UniProt: C4K8N2
Position
complement(97158..98300)
Genome map
AA seq 380 aa AA seqDB search
MNHKICPVVMLAQQLIERRSISPEDAGCQDIIAQHLNYFGFTVEPMHFGDTKNLWAWRGS
GEKTLVFVAHTDVVPAGNETLWTTPPFMPSIRDGSLYGRGAADMKGSLAAMIIAAERFVE
AHPNHRQKLAFIITSDEEASGANGTSKVVQALMARNEKVDYSLVGEPSSTERIGDVIKNG
RRGSLTAQLCIQGVQGHVAYPHLAQNPIHQALGALKELSMIEWDQGNAFFPPTSVQITGL
KAGNGVSNLIPDQLHVQFNFRFNTESTYSMIRNQVENLLERYALDYQITWILSGEPFLTP
KGELLDAVLNTVQHYCDSPPDILTTGGTSDGRFIALMGAQVVELGPINQSIHKVNESVSI
ADLQLLTKMYQRIMEQLLLT
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaatcataaaatctgtcctgtcgtgatgttggcacaacaattaattgaacgccgttca
atcagtccagaggatgctggttgccaagacatcatcgctcaacacttaaattatttcggt
tttactgttgaacccatgcattttggtgacacaaaaaatctctgggcctggagaggctcg
ggagagaaaactttggtttttgtggctcataccgatgtggtacctgcgggtaatgaaaca
ttatggacgacgcctccttttatgccatcaatacgtgatggaagtctttatgggagaggt
gccgcagatatgaaagggtctttggcggccatgatcatcgccgctgaacgttttgtcgaa
gcgcatccaaaccatcgccagaaattagcctttattattacctcagacgaagaggcctca
ggcgcaaatggaacttctaaggtcgttcaagctttaatggctcgcaatgaaaaagtggat
tatagcttagtaggggagccttcaagtaccgaacggataggagatgtcattaaaaatggc
aggcgcggctctttaacggcgcaattatgtattcagggtgtacaaggtcacgtggcttat
cctcatttggctcaaaatccgatacatcaagcattaggagctttaaaagaattgtcgatg
attgagtgggatcaaggtaacgcgttttttcctcccacaagcgtgcagataacgggttta
aaagcggggaatggggtgagtaatctgattcctgatcaattgcatgttcaatttaacttt
cgcttcaatactgaatcgacctatagcatgataagaaatcaggttgaaaatttgttagag
cgttatgcgttggattaccaaataacctggatactttccggtgaacctttcttgacaccc
aaaggtgaattgcttgatgcggttctgaatacagttcaacattactgtgatagcccccct
gacattttaaccactgggggcacttctgatgggcgttttatcgcattaatgggagcacag
gtggtggagttagggcctattaatcaaagtatccacaaagtcaatgaatcagtttcgata
gctgatcttcaactattgactaaaatgtatcaacgaattatggaacaattgctcctgacc
tga

DBGET integrated database retrieval system