KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0094Help
Entry
HDEF_0094         CDS       T00911                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HDEF_0094 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    HDEF_0094 (dapE)
Enzymes [BR:hde01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HDEF_0094 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(97158..98300)
Genome map
AA seq 380 aa AA seqDB search
MNHKICPVVMLAQQLIERRSISPEDAGCQDIIAQHLNYFGFTVEPMHFGDTKNLWAWRGS
GEKTLVFVAHTDVVPAGNETLWTTPPFMPSIRDGSLYGRGAADMKGSLAAMIIAAERFVE
AHPNHRQKLAFIITSDEEASGANGTSKVVQALMARNEKVDYSLVGEPSSTERIGDVIKNG
RRGSLTAQLCIQGVQGHVAYPHLAQNPIHQALGALKELSMIEWDQGNAFFPPTSVQITGL
KAGNGVSNLIPDQLHVQFNFRFNTESTYSMIRNQVENLLERYALDYQITWILSGEPFLTP
KGELLDAVLNTVQHYCDSPPDILTTGGTSDGRFIALMGAQVVELGPINQSIHKVNESVSI
ADLQLLTKMYQRIMEQLLLT
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaatcataaaatctgtcctgtcgtgatgttggcacaacaattaattgaacgccgttca
atcagtccagaggatgctggttgccaagacatcatcgctcaacacttaaattatttcggt
tttactgttgaacccatgcattttggtgacacaaaaaatctctgggcctggagaggctcg
ggagagaaaactttggtttttgtggctcataccgatgtggtacctgcgggtaatgaaaca
ttatggacgacgcctccttttatgccatcaatacgtgatggaagtctttatgggagaggt
gccgcagatatgaaagggtctttggcggccatgatcatcgccgctgaacgttttgtcgaa
gcgcatccaaaccatcgccagaaattagcctttattattacctcagacgaagaggcctca
ggcgcaaatggaacttctaaggtcgttcaagctttaatggctcgcaatgaaaaagtggat
tatagcttagtaggggagccttcaagtaccgaacggataggagatgtcattaaaaatggc
aggcgcggctctttaacggcgcaattatgtattcagggtgtacaaggtcacgtggcttat
cctcatttggctcaaaatccgatacatcaagcattaggagctttaaaagaattgtcgatg
attgagtgggatcaaggtaacgcgttttttcctcccacaagcgtgcagataacgggttta
aaagcggggaatggggtgagtaatctgattcctgatcaattgcatgttcaatttaacttt
cgcttcaatactgaatcgacctatagcatgataagaaatcaggttgaaaatttgttagag
cgttatgcgttggattaccaaataacctggatactttccggtgaacctttcttgacaccc
aaaggtgaattgcttgatgcggttctgaatacagttcaacattactgtgatagcccccct
gacattttaaccactgggggcacttctgatgggcgttttatcgcattaatgggagcacag
gtggtggagttagggcctattaatcaaagtatccacaaagtcaatgaatcagtttcgata
gctgatcttcaactattgactaaaatgtatcaacgaattatggaacaattgctcctgacc
tga

DBGET integrated database retrieval system