KEGG   Candidatus Hamiltonella defensa: HDEF_0267Help
Entry
HDEF_0267         CDS       T00911                                 

Gene name
gpmA
Definition
phosphoglyceromutase 1
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hde  Candidatus Hamiltonella defensa
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:hde01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hde01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hde00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:hde00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hde00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(265808..266557)
Genome map
AA seq 249 aa AA seqDB search
MTIKKLILVRHGESEWNKENRFTGWADVDLSEKGRVEAQQAGNLLKKKGFSFDFAYTSVL
RRATNTLSLILDVLQQQNLPIEKSWRLNERHYGALQGLNKSETAAKFGSEQVKQWRRGFS
TLPPALNLNDPRAPANDSLYATLNKNDLPLTESLATTVDRVVPYWDEVVKPRIIDGKRVI
IVAHGNSIRALVKYVDHLSEEEIMEINIPTAVPLVYEFNSSLQPINHYYLGNAEEITQKV
AAVAAQGKA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgacaataaaaaaattaattttagtaagacatggtgagagtgaatggaacaaagaaaat
cgttttactggttgggctgatgttgatctatccgaaaaaggtcgtgttgaagcacaacag
gccggtaatttactaaaaaaaaaaggattctcttttgactttgcttacacttccgtttta
cgacgtgccactaatacgctttctctcattctagatgtactgcaacaacagaatctacca
atcgaaaaatcctggcgcctgaatgagcgtcattatggcgcactccaaggtctcaataaa
tcagagacagcggcaaaattcggatctgaacaagtgaagcaatggcgtagaggattttca
accttgcctcctgcattaaatttaaatgatccccgtgctcctgctaatgatagcctgtat
gctacactcaataaaaatgatctgccgctgacagagagcttagccaccaccgtcgatcgt
gtcgtgccttattgggatgaagtggttaagccccgtatcatcgatggaaaaagggtaatt
attgtcgctcatggaaattctattcgtgcgctcgtcaaatatgttgatcatttaagtgaa
gaagaaattatggaaattaatattccaacggccgttcctttggtgtatgaatttaattca
tctttgcagcctatcaaccattattatttaggcaacgcagaagaaattactcaaaaagtg
gctgcggtggcagctcaaggaaaagcttga

DBGET integrated database retrieval system