KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0409Help
Entry
HDEF_0409         CDS       T00911                                 

Definition
phage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Brite
Enzymes [BR:hde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     HDEF_0409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(413042..413407)
Genome map
AA seq 121 aa AA seqDB search
MEHINYGHTSGVQAGDVITPEQAEAFFREDIPIITAHLNQLIKVRVNQNQFDALVSLIFK
IGSRVFAVSTLLKKLNSGAAAEFPKDCHGTVQGKKMPLPGLVARRQKEKVLFESELKAMK
T
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggagcatattaactatggtcatacctccggggtccaggcaggggacgtcatcacccct
gagcaggccgaggcgttctttcgtgaagatatcccaatcatcacagctcacctcaatcaa
ttgataaaagtgcgcgtgaaccaaaatcagttcgatgccttagtctctctgatctttaag
atcggctccagggtttttgccgtctcaacgctgctcaaaaaactaaactcaggcgcagcc
gcagagttcccaaaagattgccatggcacagttcaagggaaaaaaatgcccttaccagga
ctcgtcgcacggagacaaaaagaaaaagtgctgtttgaatctgaactgaaagcaatgaaa
acctaa

DBGET integrated database retrieval system