KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0500Help
Entry
HDEF_0500         CDS       T00911                                 

Gene name
holD
Definition
(GenBank) DNA polymerase III, psi subunit
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00230  Purine metabolism
hde00240  Pyrimidine metabolism
hde01100  Metabolic pathways
hde03030  DNA replication
hde03430  Mismatch repair
hde03440  Homologous recombination
Module
hde_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:hde00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HDEF_0500 (holD)
   00240 Pyrimidine metabolism
    HDEF_0500 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    HDEF_0500 (holD)
   03430 Mismatch repair
    HDEF_0500 (holD)
   03440 Homologous recombination
    HDEF_0500 (holD)
Enzymes [BR:hde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     HDEF_0500 (holD)
DNA replication proteins [BR:hde03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     HDEF_0500 (holD)
DNA repair and recombination proteins [BR:hde03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     HDEF_0500 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi
Motif
Other DBs
NCBI-ProteinID: ACQ67254
UniProt: C4K3W1
Position
complement(500793..501227)
Genome map
AA seq 144 aa AA seqDB search
MSNRDRLLQQLGITQWVLKHPSVFQGEMFLQLTENIRFIIVGDPLPAYDNDLIKDVLQAL
RLEPNQVYFLMPFQLKMFPKNTRCHSWRLGVRESLSLIGVQLYSPKWDDFYQNGKAKHAL
WKQICDHETDFYFNCGRSADGISN
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaccgagatcgattattacaacagcttggaatcacacaatgggtattaaaacac
ccctctgtgtttcaaggtgaaatgtttcttcagttaacggaaaatatccgttttatcatt
gtaggagatcctcttcctgcttatgataatgatttaatcaaagatgtattgcaggcgtta
cgtttagaacccaatcaagtgtattttttaatgccttttcagttaaaaatgtttcctaaa
aatactcgttgccatagctggcgattaggggtaagagaatctctatctttgataggggtt
caattatacagcccaaaatgggatgatttttatcaaaatgggaaagccaaacacgctctt
tggaagcaaatttgtgatcatgaaacagatttctattttaactgcggtagatctgccgat
ggcatatcaaattga

DBGET integrated database retrieval system