KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0611Help
Entry
HDEF_0611         CDS       T00911                                 

Gene name
glyQ
Definition
glycyl-tRNA synthetase subunit alpha
Orthology
K01878  
glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:hde00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    HDEF_0611 (glyQ)
Enzymes [BR:hde01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     HDEF_0611 (glyQ)
Amino acid related enzymes [BR:hde01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   HDEF_0611 (glyQ)
Transfer RNA biogenesis [BR:hde03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    HDEF_0611 (glyQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
594851..595765
Genome map
AA seq 304 aa AA seqDB search
MKKLKDNTFQNLIFRLQNYWADQGCTLVQPLDIEVGAGTSHPMTFLRAIGPEPIAAAYVQ
PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNMQELYLNSLQELGLDSSVHDIRFVEDN
WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYLQGVDTV
YDVLWSKSLFGPIYYSDIYHQNEVEQSFYNFEYADVDFLFFCFSQYEKEAQTLLSLKKPL
PLPAYERILKASHIFNLLDARKAISVTERQHYILRIRTLTHMVAKAYYASREALGFPMIR
MNKK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacttaaagataatacctttcaaaatcttatttttagattgcaaaattactgg
gcagatcaaggatgcacccttgttcaacctttagatatagaagtcggcgcagggacctct
catcccatgacctttctgagagcgattggcccggagcccatcgcggcggcgtacgtccaa
ccttcacggcgcccgactgatggccgttatggagaaaatcccaaccgacttcagcattat
taccagtttcaggtgatcatcaaaccttcccctgacaatatgcaggaactttatttaaat
tctctccaagagctgggattagattctagtgtccacgatatccgctttgttgaggataat
tgggaaaatccgacattaggtgcttggggattaggttgggaagtctggcttaatggtatg
gaagttacccaattcacctattttcaacaggtaggcgggctcgaatgtaaacctgtcacg
ggggagataacttatggtctagagcgtcttgcgatgtatctacaaggtgtcgacactgta
tatgatgtgctttggtcaaaaagtctatttggtccaatatactattcagatatctaccat
caaaatgaagtagaacaatcgttctataactttgaatatgcagatgtcgattttctgttt
ttctgtttttcacagtatgaaaaagaagcccaaacgttattgtccctaaaaaaaccgtta
cctttaccagcctacgaacgcattctaaaagcgagccacatttttaatctacttgatgcc
cgtaaagccatttccgtgactgaacgtcaacactatattttacggattcgcacgctcact
catatggtcgccaaagcttattatgcctctcgtgaggccttaggatttcctatgatccga
atgaataaaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system