KEGG   Candidatus Hamiltonella defensa: HDEF_0611Help
Entry
HDEF_0611         CDS       T00911                                 

Gene name
glyQ
Definition
glycyl-tRNA synthetase subunit alpha
Orthology
K01878  
glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
hde  Candidatus Hamiltonella defensa
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:hde00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
594851..595765
Genome map
AA seq 304 aa AA seqDB search
MKKLKDNTFQNLIFRLQNYWADQGCTLVQPLDIEVGAGTSHPMTFLRAIGPEPIAAAYVQ
PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNMQELYLNSLQELGLDSSVHDIRFVEDN
WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYLQGVDTV
YDVLWSKSLFGPIYYSDIYHQNEVEQSFYNFEYADVDFLFFCFSQYEKEAQTLLSLKKPL
PLPAYERILKASHIFNLLDARKAISVTERQHYILRIRTLTHMVAKAYYASREALGFPMIR
MNKK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacttaaagataatacctttcaaaatcttatttttagattgcaaaattactgg
gcagatcaaggatgcacccttgttcaacctttagatatagaagtcggcgcagggacctct
catcccatgacctttctgagagcgattggcccggagcccatcgcggcggcgtacgtccaa
ccttcacggcgcccgactgatggccgttatggagaaaatcccaaccgacttcagcattat
taccagtttcaggtgatcatcaaaccttcccctgacaatatgcaggaactttatttaaat
tctctccaagagctgggattagattctagtgtccacgatatccgctttgttgaggataat
tgggaaaatccgacattaggtgcttggggattaggttgggaagtctggcttaatggtatg
gaagttacccaattcacctattttcaacaggtaggcgggctcgaatgtaaacctgtcacg
ggggagataacttatggtctagagcgtcttgcgatgtatctacaaggtgtcgacactgta
tatgatgtgctttggtcaaaaagtctatttggtccaatatactattcagatatctaccat
caaaatgaagtagaacaatcgttctataactttgaatatgcagatgtcgattttctgttt
ttctgtttttcacagtatgaaaaagaagcccaaacgttattgtccctaaaaaaaccgtta
cctttaccagcctacgaacgcattctaaaagcgagccacatttttaatctacttgatgcc
cgtaaagccatttccgtgactgaacgtcaacactatattttacggattcgcacgctcact
catatggtcgccaaagcttattatgcctctcgtgaggccttaggatttcctatgatccga
atgaataaaaaataa

DBGET integrated database retrieval system