KEGG   Candidatus Hamiltonella defensa: HDEF_0624Help
Entry
HDEF_0624         CDS       T00911                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
hde  Candidatus Hamiltonella defensa
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hde00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
618580..619215
Genome map
AA seq 211 aa AA seqDB search
MEGTLYIISAPSGAGKSSLIQAFLKTSPSCEIKVSISYTTRAKRSTEKHGEHYFFVSDKE
FRQLIKEDAFLEYAQVFGYYYGTSRSYIEAILSNGRDVFLDIDWQGARQIRAKMPKARSI
FILPPSKEALMHRLQSRQQDAQQFIDQRMAQAVMEMAHFIEYDYLIVNDDFEQALLDIKN
IIYGERLHLKKQQERHHNLISKLLLEHPHKV
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcactctttatattatttctgccccgagtggggctggaaaatcgagccttatt
caggcttttttaaaaacatcaccttcgtgcgagataaaggtttctatttcatataccact
cgtgctaaacgctcaactgaaaaacatggggagcattatttttttgtttctgataaagaa
tttcgccaactcattaaagaagatgcctttttagaatacgcacaagtttttgggtattac
tatggaacatctcgttcatatatcgaagcgattttatcaaacggacgtgacgttttttta
gatattgattggcagggagcacgacagatcagagctaaaatgccaaaagcgcgcagtatt
tttattttgccaccttcaaaagaggcattgatgcatcgtttgcaaagccgccagcaagat
gctcaacagttcattgatcagcgtatggcacaggcagtgatggaaatggcgcattttata
gaatatgattatttgatagtaaatgatgattttgaacaggctttgctggatatcaaaaat
atcatttacggtgaacggttacatctcaaaaaacagcaagaacgccatcataatttaatc
agcaagcttcttttagaacatccccataaagtctag

DBGET integrated database retrieval system