KEGG   Candidatus Hamiltonella defensa: HDEF_0704Help
Entry
HDEF_0704         CDS       T00911                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hde  Candidatus Hamiltonella defensa
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hde00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
693168..693914
Genome map
AA seq 248 aa AA seqDB search
MVVLVTRPSPMGEELVQFIQAHGHTAYHYPLIEFSQGRDLMELSQRITQMREEDMIFVVS
KTAIDYLASFFKNNPLSWPPSIFYYAIGRNTAQAWQKINPFKIRYPLNQETSEGLLALAN
LQFINKKTALILRGNGGRELLGDRLKKRGAQIIYCECYQRHPVHYDGAQKSIQWQRLKVD
TVVVTSEEMLHRIYALVPEEARFAWLIKSRLIVVSARLANIATHLGWHHIQIAENASNES
LLHTVLSI
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggttgttttagtcacccgaccttcaccaatgggggaagaattggttcaatttattcag
gcgcacggacatacggcctatcattatcccttaattgaattttctcaagggcgagatctg
atggagttgtctcaacggataacacagatgcgagaagaagatatgatatttgttgtgtca
aaaactgcgattgattacttagcctctttttttaaaaacaatcctctttcttggcctcca
tctattttttattatgcgattggtcgaaatacggcacaagcatggcagaagatcaacccc
tttaaaattcgatatccgttgaatcaagaaaccagcgaaggcctattggctttagcgaat
ttacaattcatcaacaaaaaaacagcactgatactcagaggaaatggaggcagagaatta
ttaggtgaccgcttgaaaaaacggggggctcagatcatttattgcgagtgttatcaacgt
catcctgttcactatgatggcgcgcaaaaaagtattcaatggcagcggttaaaagtagat
actgttgtggtgaccagcgaagaaatgttacatcgtatctatgctctggttcctgaagaa
gcgcgttttgcctggctcataaaatcccgtttaatagtggtcagtgcacgtttggcgaat
atagccactcatctgggttggcatcatattcagatagctgaaaatgcaagtaatgaatcc
ctacttcatacggtgctctcgatttaa

DBGET integrated database retrieval system