KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1007Help
Entry
HDEF_1007         CDS       T00911                                 

Definition
phage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Brite
Enzymes [BR:hde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     HDEF_1007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
992210..992707
Genome map
AA seq 165 aa AA seqDB search
MNNQLKKRLLVATAGGVLALAAVLVQWHEGKRYKPYRDGGGVLTVCHGHTGKDVTPEEIY
SEEECSELMRRDLQIARSVVEHYVTFPLSDLQKAALTSFVYNIGSGAFERSTLLKKLNVG
DLSGACDEMRRWKYDEGKVSKGLINRRAIERELCLKPDLLTSPTQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcaacttaaaaaacgccttctggtggcaacggcaggcggtgtattagcactt
gctgctgtcctggtacaatggcatgaaggtaagcgctataagccctatcgtgatgggggc
ggtgtgctcactgtttgtcacggtcatacgggtaaggacgttacgccagaggaaatctat
agcgaagaagagtgtagcgagttgatgaggcgggatttgcagatagcacgttccgtagtt
gaacattatgtcactttcccgctatccgatttacagaaagccgccttgacttcatttgtt
tacaacatcggcagtggggcgtttgagcgctcaacgctgctgaaaaagctgaacgtcgga
gatttgagcggagcctgtgatgagatgcgccgctggaaatatgacgaaggaaaagtatca
aaaggattgattaaccgtagggccatagagcgcgaactttgtttaaagccagatttactc
accagtccgactcaatga

DBGET integrated database retrieval system