KEGG   Candidatus Hamiltonella defensa: HDEF_1308Help
Entry
HDEF_1308         CDS       T00911                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hde  Candidatus Hamiltonella defensa
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hde00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1220912..1222099)
Genome map
AA seq 395 aa AA seqDB search
MKQLAILGSTGSIGCSTLAVVRTNPHLFSVTALVASSNVQRMAKQCEEFHPRYASMSNEK
LAQELRLLLAKKNIKTEVFSGSKAACELAMLTEVDQVMAAIVGVAGLTPTLAAIRAGKKV
LLANKESLITCGRIFMNAVKKYGAQLLPIDSEHNAIFQSLPQKIQRELGNLSLSENGVSS
IILTGSGGSLRDIPLEEFSRITPEKACAHPNWSMGKKISVDSATMMNKGLEYIEARWLFN
ASDQQIEILLHPQSVIHSMVCYKDGSILAQLGAPDMRTPIAHAMAYPERINSGSPSLDFY
SMNALTFSKPDPARYPCLQLAIHAFKSGQSATTILNAANEVAVEAFLNTKIRFTDIAMIN
QKVLDQLSLPEPRDVQEVLDIDRQARQKAEKILLA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagctggcgattcttggttctactggttctattggctgcagcactttagccgta
gtacgaaccaaccctcacttattttctgtcaccgccctggttgccagctccaatgttcaa
cggatggcaaaacaatgcgaagaatttcatcctcgttatgcctctatgtccaatgaaaaa
ttggcacaggagcttcgtttgttattagcaaaaaaaaatataaaaacagaagtattttct
ggttctaaggcggcttgtgaattagccatgttaacagaggtagatcaagtgatggctgcc
atagtgggtgtagctggtttaacaccgacccttgctgccattcgtgctggcaaaaaagtg
cttttggccaataaggaatctctcattacttgtggtcgtatttttatgaatgccgtaaaa
aagtatggcgcacaactgttacctattgatagcgaacataatgctatttttcaaagctta
ccccaaaaaatacaacgagaattaggtaatctatctttatctgaaaatggagtttcaagc
atcattttaactggctccggtggctcattacgtgatattcccttagaagaattttctcgc
atcacacccgaaaaagcctgtgctcatccaaattggtctatggggaaaaaaatatcagta
gattcggctactatgatgaataaaggtcttgaatacatcgaggctcgttggctatttaat
gcgtctgatcaacaaattgaaattttactacatcctcaatctgtgattcattctatggtt
tgttataaagatggcagtatactggcgcaattaggagcccctgatatgcgaacaccgatt
gctcatgccatggcctatccagaaaggatcaactcgggcagtccctctttggatttttat
agtatgaatgcattgactttttcaaaacctgatcccgctcgctatccttgtctacaattg
gcgatacatgccttcaagagcggccaatcagcaaccacgatattaaatgctgccaacgaa
gtggctgtagaggcctttttaaacacaaaaattcgttttacggatattgcgatgatcaat
caaaaagtcctggaccagctcagcttgccggagcccagggatgtgcaggaagtactagat
attgatcgtcaagctcgtcaaaaagcagaaaaaattcttttggcatga

DBGET integrated database retrieval system