KEGG   Candidatus Hamiltonella defensa: HDEF_1313Help
Entry
HDEF_1313         CDS       T00911                                 

Gene name
pldA
Definition
phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
hde  Candidatus Hamiltonella defensa
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hde00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:hde00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:hde00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1225757..1226647)
Genome map
AA seq 296 aa AA seqDB search
MTYYPKSIFKPIAYSIICFVTGAFSLCDAQELTSAEMSDKEVKKKGIVANLLHDEGNIFH
LYSYEKNFLLYTFTNHINKKAISKYSWAEKAKKNELLFQFSVGFPIWKGIIGDNSLLGAS
YTQRSWWQMLNIQESSPFRETNYEPQLFLGWATHYKLAGWVLRDIQIGINHQSNGRSQET
SRSWNRVFLKLMAQNGKWKIDVMPWLRVGKIEDNPDISKYMGYYSLKTSYKLEANEISVE
TRYNWNSGYGGVNIGWSHNISSNLALYTQLFSGYGESLIDYNHRQTRFGIGFTLKI
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgacctattatccgaaatctatttttaaaccaatagcttattcaattatctgcttcgtg
acaggtgctttttcactttgtgatgcacaggaactgacaagtgctgaaatgagcgataag
gaagttaaaaagaagggtattgttgcaaatttactgcatgatgagggtaatatttttcat
ttgtactcttatgaaaaaaattttttgctttataccttcacaaaccacattaacaaaaaa
gcgataagcaaatactcgtgggctgaaaaagccaaaaaaaatgaattattattccaattt
agcgttggatttcctatatggaaaggtattatcggtgataactccttgttaggggcttct
tatacacagcgttcttggtggcaaatgctgaatatacaagaatcttctccatttagagaa
actaactatgaaccacagttgtttctaggatgggccacccattataaattagcaggatgg
gtattgcgagatatccaaataggcataaatcatcaatctaacggacgttctcaggagaca
tcccgaagctggaatcgagtatttttgaaactcatggcacaaaatggaaaatggaaaata
gatgttatgccttggctacgcgttggaaaaattgaagacaatccagatatcagtaaatat
atgggctactatagtttaaaaacaagctacaagttggaagcaaacgagattagcgtagaa
actcggtataattggaatagtggatacggcggagtcaatattggctggagccataatatt
tcatcaaacttagctttatatactcagctctttagcggctatggggaatcactgattgat
tataaccaccgacagacgagatttggcataggttttactctcaaaatatag

DBGET integrated database retrieval system