KEGG   Candidatus Hamiltonella defensa: HDEF_1675Help
Entry
HDEF_1675         CDS       T00911                                 

Gene name
F
Definition
APSE-2 prophage; lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
hde  Candidatus Hamiltonella defensa
Brite
Enzymes [BR:hde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     HDEF_1675 (F)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1522499..1522963
Genome map
AA seq 154 aa AA seqDB search
MIPKKILMAIGGSAVLLASTMVTYFEGLRHKPYKDRGDVLTVCYGHTGKAIIPGKHYTDE
ECQALLDSDLKASMAVVETHVTVPLTEMQKAALASFVYNVGSGAFVRSTLLKKLNVGDRQ
GACDEMRRWKYDEGKVSKGLINRRAVERELCLPD
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgataccgaaaaaaatcctgatggccataggtggtagtgcggtgttattagcctcgacc
atggtaacgtattttgaaggcttaaggcacaaaccctataaagacaggggtgacgtgcta
acggtgtgttacgggcatacagggaaagcgattattccgggtaaacactacacagacgaa
gaatgtcaggctttactggatagtgacctgaaggcgtcgatggcggtggttgagactcac
gttaccgttccgctgactgaaatgcagaaagcggctttggcctcattcgtttataacgta
ggaagtggggcctttgtccgttcaacgttactcaaaaaactgaatgtgggtgacagacaa
ggcgcgtgtgatgagatgcggcgctggaaatatgatgaaggtaaagtctctaaaggactg
attaatcgtcgtgcggtagagcgtgagctttgtctaccggattaa

DBGET integrated database retrieval system