KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1884Help
Entry
HDEF_1884         CDS       T00911                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with SdhC
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HDEF_1884 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HDEF_1884 (sdhD)
   00650 Butanoate metabolism
    HDEF_1884 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    HDEF_1884 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1719084..1719431
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGIQDWLLLRASAIIIALYVFYLFGFFAITPNVTYEIWQHFFAAAFTKIF
TLLTLFSILIHAWIGLWQVFTDYVKSLPLRLLLQLLVLVVLMVYVFYGTMVVWSV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcttctgctttagggcgtaatggaattcaagattggctactactgcgt
gcctctgcgattattattgcgctatatgttttttatctttttggtttttttgcgattacc
ccgaatgtaacttacgaaatttggcaacatttttttgccgctgctttcactaaaattttt
acccttctcactttattctcgattctgattcatgcctggattggcctatggcaagtattc
accgattatgtcaaatcattacctttgagactgttactacaactgctggtgttggtcgta
ttgatggtctatgtattttacggaacgatggtcgtttggagtgtttaa

DBGET integrated database retrieval system