KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1888Help
Entry
HDEF_1888         CDS       T00911                                 

Gene name
sucB
Definition
dihydrolipoyltranssuccinate transferase, component of the 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HDEF_1888 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HDEF_1888 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    HDEF_1888 (sucB)
Enzymes [BR:hde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HDEF_1888 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1724866..1726152
Genome map
AA seq 428 aa AA seqDB search
MNNTDILVPDLPESVVDATVATWHKKPGERVQRDEVLVEIETDKVVLEVPASTSGILDSI
AEDEGATVVSRQKLGQMRLEDVFSESTSQKIQKSTSTSANEKKSSEKPASDVTNESQTIE
TLSPAIRRLIAEYELDARLIKATGPGGRMTREDVEQYLSAQNDSKKIPSQPISKSEASDI
SKNTAFSAAAEQMGIHRSEKRVPMTRLRKKISERLLQAKNNTAMLTTFNEVNMKPIMDLR
KKYGEAFEKSHGVRLGLMSFYVKAVIEALKRYPEINASIDDTDIVYHHYFDISIAVSTPR
GLVTPVLRDADTLSMADIEKQVKSLALKGRDGKLKVDELTGGNFTITNGGVFGSLMSTPI
INPPQSAILGMHTIQERPMAVKGQVVILPMMYLALSYDHRLVDGRESVGYLVTIKHMLED
PVRLLLDL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaataatacagatattctggtgcctgatttacctgagtctgtggtagatgccactgtg
gccacttggcataaaaaaccaggcgaaagggttcaacgcgatgaggttttagtggaaatt
gaaaccgataaagtcgttttagaagtcccagcaagcacttctggtatcctcgattcgata
gcagaggatgaaggcgccaccgtcgtttcacgccaaaaattgggtcaaatgcggctagaa
gatgtcttttctgaatctacgtctcaaaaaatacagaaaagcacatcgacctctgccaat
gaaaaaaaatccagtgagaagccagcgtcagatgtcacaaacgaatcacaaacaatagag
actttaagcccagccattcgtcgcctgattgctgagtatgagcttgatgctcgcctgatc
aaagccacgggcccgggtgggcgtatgactcgtgaagatgtcgaacaatatttatccgct
caaaacgattcaaaaaagatcccctctcaacctatctccaagagcgaggcttctgatatt
tcaaaaaataccgctttttctgctgctgcagagcagatgggcatacatcgtagtgaaaaa
cgtgtccccatgacgcgcctgcgtaaaaaaatctctgaacgcttgctgcaggcaaaaaat
aacacggccatgttaaccacttttaacgaagtgaatatgaagcccatcatggatttacgt
aaaaaatatggtgaggcttttgaaaaaagccatggcgtacgtttaggcttaatgtctttt
tatgtgaaagcggtgatagaagccctaaaacgctatcctgaaattaatgcctctattgat
gacacggatattgtgtatcaccattattttgatatcagtattgcggtttctacgccacgt
ggtcttgtcacacctgttctgcgtgatgcggataccttaagcatggcggatattgaaaaa
caggttaagtctctggcgctgaaagggcgtgacggtaagctcaaggttgacgaattaact
ggggggaattttaccattactaacggaggggtttttggttcactcatgtctacccccatc
attaatcctcctcaaagtgccattttgggcatgcataccatccaggagcgcccaatggca
gtcaaaggtcaggttgtgatcctcccaatgatgtatttagcgctctcgtatgaccaccgt
ttggtggatggtcgtgaatctgtaggttatttggtgaccatcaaacacatgcttgaggat
cccgttcgtttattgcttgatctataa

DBGET integrated database retrieval system