KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1888Help
Entry
HDEF_1888         CDS       T00911                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyltranssuccinate transferase, component of the 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00020  Citrate cycle (TCA cycle)
hde00310  Lysine degradation
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
Module
hde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hde_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hde00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HDEF_1888 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    HDEF_1888 (sucB)
Enzymes [BR:hde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HDEF_1888 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HTH_1
Motif
Other DBs
NCBI-ProteinID: ACQ68479
UniProt: C4K7D6
Position
1724866..1726152
Genome map
AA seq 428 aa AA seqDB search
MNNTDILVPDLPESVVDATVATWHKKPGERVQRDEVLVEIETDKVVLEVPASTSGILDSI
AEDEGATVVSRQKLGQMRLEDVFSESTSQKIQKSTSTSANEKKSSEKPASDVTNESQTIE
TLSPAIRRLIAEYELDARLIKATGPGGRMTREDVEQYLSAQNDSKKIPSQPISKSEASDI
SKNTAFSAAAEQMGIHRSEKRVPMTRLRKKISERLLQAKNNTAMLTTFNEVNMKPIMDLR
KKYGEAFEKSHGVRLGLMSFYVKAVIEALKRYPEINASIDDTDIVYHHYFDISIAVSTPR
GLVTPVLRDADTLSMADIEKQVKSLALKGRDGKLKVDELTGGNFTITNGGVFGSLMSTPI
INPPQSAILGMHTIQERPMAVKGQVVILPMMYLALSYDHRLVDGRESVGYLVTIKHMLED
PVRLLLDL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaataatacagatattctggtgcctgatttacctgagtctgtggtagatgccactgtg
gccacttggcataaaaaaccaggcgaaagggttcaacgcgatgaggttttagtggaaatt
gaaaccgataaagtcgttttagaagtcccagcaagcacttctggtatcctcgattcgata
gcagaggatgaaggcgccaccgtcgtttcacgccaaaaattgggtcaaatgcggctagaa
gatgtcttttctgaatctacgtctcaaaaaatacagaaaagcacatcgacctctgccaat
gaaaaaaaatccagtgagaagccagcgtcagatgtcacaaacgaatcacaaacaatagag
actttaagcccagccattcgtcgcctgattgctgagtatgagcttgatgctcgcctgatc
aaagccacgggcccgggtgggcgtatgactcgtgaagatgtcgaacaatatttatccgct
caaaacgattcaaaaaagatcccctctcaacctatctccaagagcgaggcttctgatatt
tcaaaaaataccgctttttctgctgctgcagagcagatgggcatacatcgtagtgaaaaa
cgtgtccccatgacgcgcctgcgtaaaaaaatctctgaacgcttgctgcaggcaaaaaat
aacacggccatgttaaccacttttaacgaagtgaatatgaagcccatcatggatttacgt
aaaaaatatggtgaggcttttgaaaaaagccatggcgtacgtttaggcttaatgtctttt
tatgtgaaagcggtgatagaagccctaaaacgctatcctgaaattaatgcctctattgat
gacacggatattgtgtatcaccattattttgatatcagtattgcggtttctacgccacgt
ggtcttgtcacacctgttctgcgtgatgcggataccttaagcatggcggatattgaaaaa
caggttaagtctctggcgctgaaagggcgtgacggtaagctcaaggttgacgaattaact
ggggggaattttaccattactaacggaggggtttttggttcactcatgtctacccccatc
attaatcctcctcaaagtgccattttgggcatgcataccatccaggagcgcccaatggca
gtcaaaggtcaggttgtgatcctcccaatgatgtatttagcgctctcgtatgaccaccgt
ttggtggatggtcgtgaatctgtaggttatttggtgaccatcaaacacatgcttgaggat
cccgttcgtttattgcttgatctataa

DBGET integrated database retrieval system