KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1894Help
Entry
HDEF_1894         CDS       T00911                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase I
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00010  Glycolysis / Gluconeogenesis
hde00030  Pentose phosphate pathway
hde00051  Fructose and mannose metabolism
hde00052  Galactose metabolism
hde00680  Methane metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
hde01230  Biosynthesis of amino acids
hde03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HDEF_1894 (pfkA)
   00030 Pentose phosphate pathway
    HDEF_1894 (pfkA)
   00051 Fructose and mannose metabolism
    HDEF_1894 (pfkA)
   00052 Galactose metabolism
    HDEF_1894 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    HDEF_1894 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    HDEF_1894 (pfkA)
Enzymes [BR:hde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HDEF_1894 (pfkA)
Protein phosphatases and associated proteins [BR:hde01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HDEF_1894 (pfkA)
Messenger RNA biogenesis [BR:hde03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     HDEF_1894 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACQ68484
UniProt: C4K7E1
Position
complement(1732254..1733237)
Genome map
AA seq 327 aa AA seqDB search
MVKRIGVLTSGGDAPGMNAAIRGVVRSTLFKNKEVFGIYDGYQGLYDNQIQQLNRYSVSD
IINRGGTILGSARFPEFTQKENRARAIKNLNSHGIDALVVIGGDGSYAGAELLAKEGGIH
CVGLPGTIDNDVAGTDYSIGFFTALQTVVEAIDRLRDTSSSHQRISIVEVMGRHCGDLTL
AAAIAGGCEFIVIPEVPFDRKELITEIKAGIAKGKKHAIITITERICDINELSQYIEKET
KRETRPTVLGHIQRGGAPVAYDRILASRMGAYAVELLVQTDHKAILSCCVGVQNGKMRHA
PISECISIDNKRQKFKEDWLDVANTLF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaagaataggagtattaaccagtggaggggatgcaccaggtatgaacgccgca
atacgaggtgttgtccgctctactttatttaaaaataaagaagtttttggtatctacgac
ggctatcaaggtttgtatgataatcagatacaacaactcaatcgttacagcgtatccgat
attattaatcgaggtggcacgattcttggctctgcccgtttccctgaatttactcaaaaa
gaaaaccgggcaagggccatcaaaaatctgaactcacatgggattgatgcgctggtagtg
attgggggagatgggtcttatgcaggggctgaactgctcgcaaaagaaggcggtatccat
tgtgtcggtttacctgggactattgataacgatgtagcaggcacagattacagcattggc
ttttttactgcgttgcagacagtggtcgaagcgattgaccgcctacgtgatacatcctct
tcacatcaacgtatttctattgttgaagtcatggggcgtcattgtggcgatttgacctta
gccgcggctatcgcagggggatgcgaatttattgtgataccagaagtcccctttgatcgt
aaagagttgatcacagaaattaaggcaggtattgccaaaggcaaaaaacacgcaatcatc
actatcactgagcgtatttgtgatattaatgaattatctcaatatattgaaaaggagact
aaaagagaaaccaggcctacagtattagggcatatacaaagaggtggagcccctgttgct
tacgatcgtatcctggcttctcgaatgggcgcttacgcagtggaattattggttcaaact
gatcacaaggcaatattgagttgctgcgtgggcgttcagaatggcaaaatgcggcatgct
cccatttctgagtgtatttctatagacaataaacgccaaaaatttaaagaagattggtta
gatgtcgccaatacattattttaa

DBGET integrated database retrieval system