KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1894Help
Entry
HDEF_1894         CDS       T00911                                 

Gene name
pfkA
Definition
6-phosphofructokinase I
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:hde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HDEF_1894 (pfkA)
   01230 Biosynthesis of amino acids
    HDEF_1894 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HDEF_1894 (pfkA)
   00030 Pentose phosphate pathway
    HDEF_1894 (pfkA)
   00051 Fructose and mannose metabolism
    HDEF_1894 (pfkA)
   00052 Galactose metabolism
    HDEF_1894 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    HDEF_1894 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    HDEF_1894 (pfkA)
Enzymes [BR:hde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HDEF_1894 (pfkA)
Protein phosphatases and associated proteins [BR:hde01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HDEF_1894 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1732254..1733237)
Genome map
AA seq 327 aa AA seqDB search
MVKRIGVLTSGGDAPGMNAAIRGVVRSTLFKNKEVFGIYDGYQGLYDNQIQQLNRYSVSD
IINRGGTILGSARFPEFTQKENRARAIKNLNSHGIDALVVIGGDGSYAGAELLAKEGGIH
CVGLPGTIDNDVAGTDYSIGFFTALQTVVEAIDRLRDTSSSHQRISIVEVMGRHCGDLTL
AAAIAGGCEFIVIPEVPFDRKELITEIKAGIAKGKKHAIITITERICDINELSQYIEKET
KRETRPTVLGHIQRGGAPVAYDRILASRMGAYAVELLVQTDHKAILSCCVGVQNGKMRHA
PISECISIDNKRQKFKEDWLDVANTLF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaagaataggagtattaaccagtggaggggatgcaccaggtatgaacgccgca
atacgaggtgttgtccgctctactttatttaaaaataaagaagtttttggtatctacgac
ggctatcaaggtttgtatgataatcagatacaacaactcaatcgttacagcgtatccgat
attattaatcgaggtggcacgattcttggctctgcccgtttccctgaatttactcaaaaa
gaaaaccgggcaagggccatcaaaaatctgaactcacatgggattgatgcgctggtagtg
attgggggagatgggtcttatgcaggggctgaactgctcgcaaaagaaggcggtatccat
tgtgtcggtttacctgggactattgataacgatgtagcaggcacagattacagcattggc
ttttttactgcgttgcagacagtggtcgaagcgattgaccgcctacgtgatacatcctct
tcacatcaacgtatttctattgttgaagtcatggggcgtcattgtggcgatttgacctta
gccgcggctatcgcagggggatgcgaatttattgtgataccagaagtcccctttgatcgt
aaagagttgatcacagaaattaaggcaggtattgccaaaggcaaaaaacacgcaatcatc
actatcactgagcgtatttgtgatattaatgaattatctcaatatattgaaaaggagact
aaaagagaaaccaggcctacagtattagggcatatacaaagaggtggagcccctgttgct
tacgatcgtatcctggcttctcgaatgggcgcttacgcagtggaattattggttcaaact
gatcacaaggcaatattgagttgctgcgtgggcgttcagaatggcaaaatgcggcatgct
cccatttctgagtgtatttctatagacaataaacgccaaaaatttaaagaagattggtta
gatgtcgccaatacattattttaa

DBGET integrated database retrieval system