KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1898Help
Entry
HDEF_1898         CDS       T00911                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HDEF_1898 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HDEF_1898 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HDEF_1898 (thrC)
Enzymes [BR:hde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HDEF_1898 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1735911..1737206)
Genome map
AA seq 431 aa AA seqDB search
MKFYNLKDQNEQVSFTEAVQRGLGKQQGLFFPVTLPEFTQKEVATLLEQDFITRSLPILS
AFIGDEIPQNTLAQAIKTAFSFPAPLVRIDDKIALLELFHGPTLAFKDFGARLMAQILSI
VGKNDPITILTATSGDTGAAVANAFLGLKNIQVVILYPRGKISPLQEKLFCTLGQNIHTL
AIEGDFDACQSMVKQAFEETPLRKTLKLNSANSINISRLIAQICYYFEAVAQIPPNQRSE
LVISVPSGNFGNLTAGLLAKALGLPVKRFIASTNVNDTVPRFLIEGQWRPEKTKATLSNA
MDVSEPNNWPRIEALFRFKNWSLKELGYGVVNDKTTERTLLELNELGCLSEPHAAVAYRL
LRDQLQAGESGIFLGTAHPAKFKDKIEPILKLRLDLPPELAQRANLPLLSRNLPADYRAL
SDFLRKLPLSF
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttataatctgaaagatcagaatgaacaagtcagctttacggaggcggtgcag
cgaggtttagggaaacagcaggggttgttttttccggtcacattacccgaattcacccaa
aaagaagtggccacgttgctcgagcaggattttatcactcggagcctccctattttatcc
gcctttattggtgatgaaattcctcaaaacaccttggctcaggccatcaaaaccgcgttt
tctttccctgcgccactcgttcgcatagatgacaaaatcgctttattagaattatttcac
ggcccgaccctggcttttaaagattttggcgcgcgattgatggcgcaaatactgtcgata
gtgggtaaaaacgatccgatcactattttaacagccacctcgggagatacgggcgctgca
gtggcaaacgcctttttggggttgaaaaatatccaggtggtgatcctgtatcctcgtgga
aagataagcccgcttcaagaaaagctgttttgtacgttaggacagaatattcataccctc
gcgattgagggagattttgatgcatgccaatccatggtgaaacaggcatttgaagaaact
cctttaagaaaaacccttaagctcaactctgcgaattcgatcaacatcagccgtcttatt
gcccagatttgttattattttgaagccgtggctcaaatccctcctaaccagcgtagcgag
ctggtgatctctgtgccaagtggcaattttggaaatctgaccgccggtttactggcaaaa
gccttgggtttaccggtcaaacgatttattgcctcgaccaatgtcaatgataccgtccct
cgttttttgatagaggggcaatggcggcctgaaaaaaccaaagccaccttgtcgaacgcc
atggatgtcagtgaaccgaataactggccccgaattgaggccttgtttcgttttaaaaat
tggtcattgaaagaattgggatatggcgtggtgaacgacaaaacgactgaaaggacctta
ttggaactcaatgaattaggctgtctttctgaaccccatgcagccgtagcttatcgtttg
ttacgtgatcagcttcaagcaggagaatccggcatattccttgggacggctcatcctgca
aaatttaaagacaagatagagcccattctaaaactgagactggacttaccgcctgagtta
gcacaaagagcaaatttgcctttattatccaggaatttaccggcggattatcgagctttg
tccgattttttacgaaagttaccgctttctttttaa

DBGET integrated database retrieval system