KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1898Help
Entry
HDEF_1898         CDS       T00911                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00260  Glycine, serine and threonine metabolism
hde00750  Vitamin B6 metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01230  Biosynthesis of amino acids
Module
hde_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hde00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HDEF_1898 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HDEF_1898 (thrC)
Enzymes [BR:hde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HDEF_1898 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ACQ68488
UniProt: C4K7E5
Position
complement(1735911..1737206)
Genome map
AA seq 431 aa AA seqDB search
MKFYNLKDQNEQVSFTEAVQRGLGKQQGLFFPVTLPEFTQKEVATLLEQDFITRSLPILS
AFIGDEIPQNTLAQAIKTAFSFPAPLVRIDDKIALLELFHGPTLAFKDFGARLMAQILSI
VGKNDPITILTATSGDTGAAVANAFLGLKNIQVVILYPRGKISPLQEKLFCTLGQNIHTL
AIEGDFDACQSMVKQAFEETPLRKTLKLNSANSINISRLIAQICYYFEAVAQIPPNQRSE
LVISVPSGNFGNLTAGLLAKALGLPVKRFIASTNVNDTVPRFLIEGQWRPEKTKATLSNA
MDVSEPNNWPRIEALFRFKNWSLKELGYGVVNDKTTERTLLELNELGCLSEPHAAVAYRL
LRDQLQAGESGIFLGTAHPAKFKDKIEPILKLRLDLPPELAQRANLPLLSRNLPADYRAL
SDFLRKLPLSF
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttataatctgaaagatcagaatgaacaagtcagctttacggaggcggtgcag
cgaggtttagggaaacagcaggggttgttttttccggtcacattacccgaattcacccaa
aaagaagtggccacgttgctcgagcaggattttatcactcggagcctccctattttatcc
gcctttattggtgatgaaattcctcaaaacaccttggctcaggccatcaaaaccgcgttt
tctttccctgcgccactcgttcgcatagatgacaaaatcgctttattagaattatttcac
ggcccgaccctggcttttaaagattttggcgcgcgattgatggcgcaaatactgtcgata
gtgggtaaaaacgatccgatcactattttaacagccacctcgggagatacgggcgctgca
gtggcaaacgcctttttggggttgaaaaatatccaggtggtgatcctgtatcctcgtgga
aagataagcccgcttcaagaaaagctgttttgtacgttaggacagaatattcataccctc
gcgattgagggagattttgatgcatgccaatccatggtgaaacaggcatttgaagaaact
cctttaagaaaaacccttaagctcaactctgcgaattcgatcaacatcagccgtcttatt
gcccagatttgttattattttgaagccgtggctcaaatccctcctaaccagcgtagcgag
ctggtgatctctgtgccaagtggcaattttggaaatctgaccgccggtttactggcaaaa
gccttgggtttaccggtcaaacgatttattgcctcgaccaatgtcaatgataccgtccct
cgttttttgatagaggggcaatggcggcctgaaaaaaccaaagccaccttgtcgaacgcc
atggatgtcagtgaaccgaataactggccccgaattgaggccttgtttcgttttaaaaat
tggtcattgaaagaattgggatatggcgtggtgaacgacaaaacgactgaaaggacctta
ttggaactcaatgaattaggctgtctttctgaaccccatgcagccgtagcttatcgtttg
ttacgtgatcagcttcaagcaggagaatccggcatattccttgggacggctcatcctgca
aaatttaaagacaagatagagcccattctaaaactgagactggacttaccgcctgagtta
gcacaaagagcaaatttgcctttattatccaggaatttaccggcggattatcgagctttg
tccgattttttacgaaagttaccgctttctttttaa

DBGET integrated database retrieval system