KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1940Help
Entry
HDEF_1940         CDS       T00911                                 

Gene name
ruvA
Definition
Holliday junction helicase, subunit A
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hde00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HDEF_1940 (ruvA)
Enzymes [BR:hde01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     HDEF_1940 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1775163..1775777)
Genome map
AA seq 204 aa AA seqDB search
MISRMKGIILEKQPPWILLDIQGMGYDIQLPMTCFYQLPELGQEAIIFTHFVVREDAQLL
YGFHHPKERAMFSELIKVNGVGPKLGLAILSGMSSEEFICALEKEDISNLIKLPGVGKKT
AERLLVEMKDRIKNLNKNLFKSTADHMLSSVSTDLSAKSAEAEAISALISLGYKPQEAAQ
LIKNIAQPDLDSQALIKHALRSTL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgataagcagaatgaaaggcattattttggaaaaacagccgccctggatattgttagat
attcaaggaatgggatatgacatccaacttcctatgacctgtttttatcagcttccagaa
ttggggcaagaagcgattatttttacgcattttgtggtgcgagaggatgcgcaattatta
tatgggtttcatcatcctaaagagcgggcgatgttcagtgaactgattaaagtgaatggt
gttgggccaaaacttgggttggcgattttatctggcatgtcttcagaagagtttatctgt
gcgctggaaaaagaagatatttcaaatttaatcaaattacctggagttggaaaaaaaacg
gcagagcgattgctggtggaaatgaaagatcgtatcaaaaatttaaataaaaatttattt
aaaagcacagccgatcatatgttgtcatcagtttctactgatctttcagcaaaatcggcc
gaagcagaagccatatcggcgttgatctcactaggttataaaccgcaggaagcggctcaa
ttgatcaaaaatatcgctcagccagatttagattcccaagctttaataaagcatgcttta
cgctccaccttataa

DBGET integrated database retrieval system