KEGG   Candidatus Hamiltonella defensa: HDEF_1940Help
Entry
HDEF_1940         CDS       T00911                                 

Gene name
ruvA
Definition
Holliday junction helicase, subunit A
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hde  Candidatus Hamiltonella defensa
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hde03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1775163..1775777)
Genome map
AA seq 204 aa AA seqDB search
MISRMKGIILEKQPPWILLDIQGMGYDIQLPMTCFYQLPELGQEAIIFTHFVVREDAQLL
YGFHHPKERAMFSELIKVNGVGPKLGLAILSGMSSEEFICALEKEDISNLIKLPGVGKKT
AERLLVEMKDRIKNLNKNLFKSTADHMLSSVSTDLSAKSAEAEAISALISLGYKPQEAAQ
LIKNIAQPDLDSQALIKHALRSTL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgataagcagaatgaaaggcattattttggaaaaacagccgccctggatattgttagat
attcaaggaatgggatatgacatccaacttcctatgacctgtttttatcagcttccagaa
ttggggcaagaagcgattatttttacgcattttgtggtgcgagaggatgcgcaattatta
tatgggtttcatcatcctaaagagcgggcgatgttcagtgaactgattaaagtgaatggt
gttgggccaaaacttgggttggcgattttatctggcatgtcttcagaagagtttatctgt
gcgctggaaaaagaagatatttcaaatttaatcaaattacctggagttggaaaaaaaacg
gcagagcgattgctggtggaaatgaaagatcgtatcaaaaatttaaataaaaatttattt
aaaagcacagccgatcatatgttgtcatcagtttctactgatctttcagcaaaatcggcc
gaagcagaagccatatcggcgttgatctcactaggttataaaccgcaggaagcggctcaa
ttgatcaaaaatatcgctcagccagatttagattcccaagctttaataaagcatgcttta
cgctccaccttataa

DBGET integrated database retrieval system