KEGG   Candidatus Hamiltonella defensa: HDEF_1941Help
Entry
HDEF_1941         CDS       T00911                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase, catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
hde  Candidatus Hamiltonella defensa
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hde00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hde00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1775813..1776733)
Genome map
AA seq 306 aa AA seqDB search
MTHSLYRKNIISISDLSQLELRHIMDTAAYFKNTPPVNLLKHTVIASCFFEASTRTRLSF
EAAIHRLGASVVGFSDDQFTSVSKGESLSDTLRVISSYVDAIIIRHPKEGAPQYAAGFCP
VPIINAGDGTNEHPTQTLLDLFSIQETQGRLSHLKIGLAGDLKYGRTVHSLTKALSTFPN
NEFFLISPPELSMPCPLVKELNHSVHHTIEEVLPQLDILYMTRIQQERLKPEHRHLKTAF
ILEGKHLLPGQVKTNLKILHPLPRVDEIAPEVDTTPYAYYFQQAANGMFIREALLALLLN
PHAPYP
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttgacccactctttatatcgtaaaaatattatttcaatttctgatctgagtcagctggag
ttaaggcacattatggatacggcggcgtattttaaaaacacaccgcccgtgaatctttta
aaacataccgttatcgccagttgtttttttgaagcctctacccgcactcgattatctttt
gaagcagccattcatcgtcttggggcttctgtggtgggtttttcagacgaccagtttaca
tccgtcagtaagggtgaaagcctgtctgacaccttacgcgtgatcagcagctatgtagat
gcgattatcatccggcaccccaaagaaggggctcctcaatatgctgccggtttttgccca
gtccccatcatcaatgcgggggatggtacgaatgaacaccccacacaaaccttgctggat
ttattcagtattcaagaaacacaggggcgcttaagccatctcaaaatcggtctcgccgga
gatttaaaatatggtcgaacggttcattcgctcacaaaagcactatcaacatttccaaat
aatgaattttttttaatttcgcctccagagttgtcaatgccttgtccccttgtgaaggaa
cttaatcacagcgtgcatcacacaattgaagaagtgctgcctcagcttgacattctttac
atgacccgtattcaacaagaacgcctgaaaccagagcatcgtcatcttaaaaccgctttc
attttagagggtaagcatcttcttcctggtcaggtaaaaacgaatttaaaaattttacat
cctttaccacgagtcgatgaaatagcaccagaggtagacacaacaccttatgcctattat
tttcagcaggcggcgaatgggatgtttattcgagaggctttactggcattattactcaat
cctcatgcaccatatccgtaa

DBGET integrated database retrieval system