KEGG   Candidatus Hamiltonella defensa: HDEF_2089Help
Entry
HDEF_2089         CDS       T00911                                 

Gene name
recR
Definition
gap repair protein
Orthology
K06187  
recombination protein RecR
Organism
hde  Candidatus Hamiltonella defensa
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hde03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1911243..1911851
Genome map
AA seq 202 aa AA seqDB search
MQTSLVIEALMESLRHLPGVGPKSAQRMAFYLLQSDRSKGIRLAESLLKAMSEIGHCGVC
RTFTEQPCCDICSNVYREKMGQICVVESPSDICAIEQTGQFSGRYFVLMGRLSPLDGIGP
DDIGLPLLEHRLSTEPIKEVILAMNPTVEGEATSNYIAQMCEEYGISTTKIAHGVPIGGD
LEMVDETTLSHALVGRRPMNFN
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtttggttattgaagctttgatggaatcattacgccatttgcctggggta
ggcccaaagtctgcccaacgtatggctttttacttgctacaaagtgatcgcagtaagggt
atacgtttagcagagtctttattaaaagcgatgtcggaaattggccactgtggtgtgtgt
cgtactttcactgaacaaccttgctgtgatatttgttctaatgtttatcgagaaaaaatg
ggtcaaatctgtgtcgtagaaagtccttccgacatttgcgccattgagcaaacagggcaa
ttttctggccgttactttgttttgatgggacgcttgtcacctttagatggtattggcccc
gatgatattggtttgcctttacttgagcatcgattatctacagaacccatcaaggaagtt
attttagcaatgaaccccacagtcgaaggtgaagccacttcgaactatattgcgcaaatg
tgtgaggaatacggaatatctacgactaaaattgcccatggtgtacctatcgggggtgat
cttgagatggtcgatgagactactttatctcatgcactagtgggacgacggcccatgaat
tttaactga

DBGET integrated database retrieval system