KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_2089Help
Entry
HDEF_2089         CDS       T00911                                 

Gene name
recR
Definition
gap repair protein
Orthology
K06187  
recombination protein RecR
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hde00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HDEF_2089 (recR)
DNA repair and recombination proteins [BR:hde03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HDEF_2089 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1911243..1911851
Genome map
AA seq 202 aa AA seqDB search
MQTSLVIEALMESLRHLPGVGPKSAQRMAFYLLQSDRSKGIRLAESLLKAMSEIGHCGVC
RTFTEQPCCDICSNVYREKMGQICVVESPSDICAIEQTGQFSGRYFVLMGRLSPLDGIGP
DDIGLPLLEHRLSTEPIKEVILAMNPTVEGEATSNYIAQMCEEYGISTTKIAHGVPIGGD
LEMVDETTLSHALVGRRPMNFN
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtttggttattgaagctttgatggaatcattacgccatttgcctggggta
ggcccaaagtctgcccaacgtatggctttttacttgctacaaagtgatcgcagtaagggt
atacgtttagcagagtctttattaaaagcgatgtcggaaattggccactgtggtgtgtgt
cgtactttcactgaacaaccttgctgtgatatttgttctaatgtttatcgagaaaaaatg
ggtcaaatctgtgtcgtagaaagtccttccgacatttgcgccattgagcaaacagggcaa
ttttctggccgttactttgttttgatgggacgcttgtcacctttagatggtattggcccc
gatgatattggtttgcctttacttgagcatcgattatctacagaacccatcaaggaagtt
attttagcaatgaaccccacagtcgaaggtgaagccacttcgaactatattgcgcaaatg
tgtgaggaatacggaatatctacgactaaaattgcccatggtgtacctatcgggggtgat
cttgagatggtcgatgagactactttatctcatgcactagtgggacgacggcccatgaat
tttaactga

DBGET integrated database retrieval system