KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_2111Help
Entry
HDEF_2111         CDS       T00911                                 

Gene name
hemB
Definition
(GenBank) 5-aminolevulinate dehydratase (porphobilinogen synthase)
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00860  Porphyrin and chlorophyll metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HDEF_2111 (hemB)
Enzymes [BR:hde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     HDEF_2111 (hemB)
Exosome [BR:hde04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HDEF_2111 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ACQ68676
UniProt: C4K7Y3
Position
complement(1933352..1934368)
Genome map
AA seq 338 aa AA seqDB search
MNDCLSTFPYRRMRRGRRYGFSRRLLAEHHLSLNDLIYPVFIMEGHCRREEIVSMPGIFR
MSMDLLLKEAEQVAQLGIPVMALFPVIDPSLKSLQAEQAYHPEGLVQRAIRLLKKHLPQL
GVLADVALDPYTCHGQDGVIDEHQDVINDLTNKILVRQALSQAEAGVDIIAPSDMMDGRI
RVIRSELEKQGFYNTQIMAYSAKYASCYYGPFREAVGSSHHLKGGHKKTYQMEPANTDEA
LQEVALDIQEGADMVMVKPGMPYLDVVRRVKETFGVPTFAYQVSGEYAMHQAAIQNGWLQ
EKDVIMESLLCFKRAGADGILTYFAKQVAQWLNENYQK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattgcctaagcactttcccctatcgtcgtatgcgccgtgggcgccgatatggt
ttcagccgtcgtttactggctgaacatcatctcagcttaaatgacctgatttaccccgta
tttatcatggaaggtcattgtcgccgtgaagagatcgtttcgatgcctggcatttttagg
atgagcatggatctcttactcaaagaggcagagcaggtggctcaattaggcattcctgtg
atggctttatttccagtgattgatccgagcctcaaatcattacaggcagaacaagcctat
catcccgaaggattggtgcaacgcgccattcgcttattaaaaaaacatttacctcagttg
ggtgtcttagccgatgtggcattagatccatatacctgccatggtcaagatggtgttatc
gatgaacatcaggatgtgatcaatgatctcaccaacaagattttagtacgtcaggctttg
tctcaagcagaagcaggcgtagatattatcgcgccgagcgatatgatggacgggcgtatc
agagtgattcgatctgaattggaaaagcagggcttttataatacacaaatcatggcgtat
tcagcaaaatatgcttcctgttattatggcccttttcgtgaagccgttggttcgagccat
cacttaaagggaggccataaaaaaacatatcaaatggagcccgctaacactgatgaagct
ttacaggaagtggctctagatatacaagaaggcgcggatatggtcatggtaaaacctggc
atgccttatttggatgttgtacgccgagtcaaggagacttttggagtgcccacttttgct
tatcaagtctctggcgaatatgccatgcatcaagccgccatccaaaacggatggctacaa
gaaaaagacgttattatggaatcattactttgttttaagcgtgcgggtgcagacggcatc
ttaacttattttgcgaaacaggtagcacaatggctaaatgaaaattatcaaaaataa

DBGET integrated database retrieval system