KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_0030Help
Entry
Hden_0030         CDS       T01265                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hden_0030
  Amino acid metabolism
   00300 Lysine biosynthesis
    Hden_0030
Enzymes [BR:hdn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Hden_0030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(32565..33737)
Genome map
AA seq 390 aa AA seqDB search
MTLNPTDPVTLTQALIRCESVTPDEGGALTLLQNVLEPAGFTCHRLVFSEPGTPDVDNLY
ARLGSGRPHLSFAGHTDVVPVGDEKVWTVPPFSGDIRDGKVYGRGAVDMKGCVAAFVSAA
LKYIHHHNGLPRGSLSFLITGDEEGPSINGTMKILDWLKSRDEVVDACLVGEPSNPKALG
DEIRIGRRGSVNAEIVVHGKQGHSAYPQLADNPVPKLARLIDRLSTAKLDDGTPDFQPSN
LQVTVISVPNTATNVIPGQAVAKINIRYNDLWHRPTIEAWVRDKLAHAAAEVGAKYEVSF
SGTGDVFLTKPGPLVSTLTDAVQSVTGRIPKLTTGGGTSDARFIKDICPVVEFGLVNATI
HQVDEHTSIVDLEQLTEIYGRFITNYFRTE
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcaatccgaccgatcccgtgaccctgacgcaggctcttattcgctgcgaaagc
gtgacgcctgacgaagggggcgcgctgacgctgctgcaaaatgtgctggagcctgcaggt
ttcacctgtcaccggctggtattttccgaacccggcacgcccgacgtcgataacctgtac
gcacgcctcggctcgggccgaccgcatctttccttcgcgggccacaccgacgtcgtgccc
gtcggcgatgaaaaggtctggacggtcccgccgttctccggcgacatccgcgacggcaag
gtctacggacgcggcgccgtcgacatgaagggctgtgtggcggctttcgtttccgcggcc
ctgaagtacattcaccatcacaacggcctaccgcgcggctcgctgtcgttcttgatcacg
ggtgacgaagaaggcccctcgatcaacggcacgatgaaaatcctggattggctgaagtcg
cgggacgaagtcgtcgacgcctgcctcgtcggcgaaccatcgaacccgaaggctttgggc
gacgaaatccgcatcggccgccgcggctccgtcaacgccgagatcgttgtgcacgggaag
caaggacattccgcctatccgcagctcgccgacaatcccgtaccgaagctcgcacgcctc
atcgaccgcttgtcgacggcgaagctcgacgacggcacgccggacttccagccgtccaac
ctgcaggtgacggtcatctcggtgccaaacaccgcgaccaacgtcatccccggccaggcc
gtcgccaagatcaacatccgctataacgatctctggcaccgtccgacgatcgaagcctgg
gttcgcgacaaactcgcacacgcggcggccgaagtcggagcgaagtatgaagtcagcttc
tcgggcaccggcgacgtcttcctgacgaagcccggtcctctcgtctccacgctgacagac
gccgttcaatccgtgaccggccgcattccgaagctgacgaccggaggcggcacgtcggac
gcccgcttcatcaaggacatttgtcctgtcgtcgaatttggtctggtcaacgccacgatc
caccaggtcgacgagcacaccagcattgtcgatctcgaacagctgaccgagatctatggc
cgcttcatcacgaattatttccgcactgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system