KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_0221Help
Entry
Hden_0221         CDS       T01265                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hdn00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:hdn00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(218793..219944)
Genome map
AA seq 383 aa AA seqDB search
MKGMLARLGWLGSAMLVIVVALAIFYGSGHFRKHALRASILQSDPARLERLGRRLIVGYK
DVAKIKALVEKRAIAGIFLTTRNAQDRTADQIRSEIERLQAIRKAQGLPRLIVAADQEGG
IVSHLSPPLTAQPSLGATISNLNSDDEREKAVKAYAATQARELQTLGVNMNFGPVVDLQS
SAAPANDSGSRIYSRAISSDPEIVAKVAVWYCETLAEFDVTCTLKHFPGLGRVANDTHVV
AGTLATPEPQLEREDWLPFQRLKNDPRFAMMIGHVRVDAIDPTLPASYSSEMIDGLLRSR
WKVDALLVTDDFGMGAILESKDGIGEAAVKALNAGVDLVLLSNSDKHFDTVMAALLAADS
GGLIRKDLESETFRRLVRASEHP
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaagggaatgctcgcacggctcggctggttgggctccgcgatgctcgtcatcgtggtc
gctctcgcaattttttatggctccggtcatttccgcaaacatgccttgcgagcttccatt
cttcaatctgaccccgcacgtctggagcgcctaggccgacggttgatcgtcggatacaag
gacgtcgcaaagatcaaagcgctcgtcgaaaagcgcgcaatcgccggcatattcctcacc
acacgtaacgcgcaggatcgcactgccgatcagattcgctccgagatcgagcgcttgcag
gcgatccgaaaagctcaaggcttgcctcgcctcatcgttgccgcagatcaggaaggcggt
atcgtttcgcatctgtcgccgccactgacggctcagccttcgcttggcgcgacgatctcc
aacctgaattccgatgacgaacgggaaaaggcggtcaaagcgtatgccgcaactcaagct
cgcgaactgcagacgctgggcgtaaacatgaacttcggaccggtcgtcgacttgcaatcg
tcagccgctcccgccaacgacagcggaagccggatctactcacgagcgatttccagcgat
cccgagatcgtcgcaaaagttgcggtctggtactgcgagacactcgcagaattcgatgtc
acgtgcacgttgaaacacttcccaggcctcgggcgcgtcgcaaacgatacgcacgtcgta
gccggcacgctcgcgactcccgaaccgcaactcgagcgcgaggactggctgccgtttcag
cgcctcaagaacgatccccgtttcgctatgatgatcggtcacgtgcgcgtcgacgcgata
gatccaacgctccctgcctcatattcttcagagatgatcgacgggctgctccgctcacgc
tggaaggtcgatgccttgctcgtcaccgatgattttggaatgggagcgatcctcgagtcg
aaagacggcatcggggaagcggcggtcaaagcactcaatgcgggcgttgacctcgtgctg
ctgtccaactctgacaagcatttcgatactgtgatggcggctctgctcgcagcggatagc
gggggccttatccgcaaggacttggaatcagagacttttcgcaggcttgttcgcgcttca
gagcacccttag

DBGET integrated database retrieval system