KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_0404Help
Entry
Hden_0404         CDS       T01265                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
hdn00220  Arginine biosynthesis
hdn00250  Alanine, aspartate and glutamate metabolism
hdn00471  D-Glutamine and D-glutamate metabolism
hdn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Hden_0404
   00220 Arginine biosynthesis
    Hden_0404
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Hden_0404
Enzymes [BR:hdn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Hden_0404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ADJ22226
JGI: Hden_0404
UniProt: D8JRJ7
Position
complement(412712..413647)
Genome map
AA seq 311 aa AA seqDB search
MTIEMADLKRLLDTVRDELQSVDHPGKVADYIPELAKIDPKKFAISITNLKGETVSTGDD
VEPFSIQSISKVFGLALALGKVGDALWKRVGREPSGSAFNSIVQLEHEQGIPRNPFINSG
AIVVADVLLAGHRPREAIAEILRFVRIAANDDTIMIDPAVARSEQATGFRNFALANYMRA
FGNLNHPSELTLGVYFHQCAIEMTARQLSEAGVFLANGGRDPRSGLTIVSKERARRINAL
MLTCGHYDGSGDFAYRVGLPGKSGVGGGILAIVPGEASIAVWSPALNAQGNSLLGTRALE
LIVRETGWSAF
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
ttgacgattgaaatggccgacctcaaacgtctcctcgataccgtgcgcgatgagcttcag
tcggtggaccatcccggcaaggttgccgactacattcccgagctcgcgaagattgatcca
aaaaaattcgcgatttcgatcaccaatctcaaaggcgagacggtctcgaccggcgacgat
gtcgaaccgttttcgatacaaagcatctccaaggtcttcggccttgcattggcactcggc
aaggttggtgacgcactctggaaacgcgtcgggcgcgagccatccggcagcgccttcaat
tcaatcgttcagctcgaacacgaacagggaatcccccgaaatcccttcatcaactcgggc
gccatcgtcgtcgccgacgtcctgctcgcgggccaccgcccgcgcgaggcgatcgccgaa
atcctgcgctttgtccggattgccgccaacgacgacacgatcatgatcgacccggccgtc
gcacgctccgagcaggcaaccggctttcgcaatttcgcgctggcaaactacatgcgcgca
ttcggcaacctgaatcatccgagcgagctgacgctcggcgtgtatttccatcaatgcgcg
atcgagatgacggcgcggcagctttcggaagccggcgtctttcttgcgaacggcggccgc
gacccgcgtagcggcttgacgatcgtgtcgaaggagcgcgcccgccgcatcaacgcgctg
atgttgacctgcggccactacgacggttccggcgacttcgcatatcgcgtcggcttgccg
ggcaagagcggagtgggtggtggaatattggcaattgttccgggagaggcatccatcgcc
gtctggtcgcccgcactcaacgcgcagggaaactcattgctcggcacgcgcgcattggaa
ctcatcgttcgcgaaaccggatggtcggcgttctga

DBGET integrated database retrieval system