KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_0636Help
Entry
Hden_0636         CDS       T01265                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Hden_0636
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Hden_0636
Enzymes [BR:hdn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Hden_0636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(668440..669411)
Genome map
AA seq 323 aa AA seqDB search
MTSKPNSNALKVFPRRHLLTCEGLSANEINFVLDLADKAADHIRQNGKKRDVLDGRTLIN
LFFESSTRTQASFEMAGKRLGADVMNMNVATSSVTKGETLVDTAVTLNAMRPDIIVVRHH
AAGAVELLSQKVDCSVINAGDGAHQHPTQALLDALTIRRAKGRVAGLTVAICGDILHSRV
ARSNINVLNALGAQVRLVAPSTLLPSSPERLGTEVYTDMWKGIDGVDVVMMLRLQRERMD
ASYVPSSREFFHFFGLDHEKLARAKPDALVMHPGPMNRGVEIASTVADHSRSVIREQVEM
GVAVRMAVLEALSAHLPSFKDVA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaaaccgaactcgaacgcgctgaaagtttttccgcgccgccatttgctgacc
tgcgaggggctgtcggcgaatgagatcaattttgtgctcgatcttgccgacaaggctgcc
gatcacatccggcagaacggcaagaagcgcgacgtcctcgacgggcgcacgctgatcaat
ctcttctttgaatcctcgaccagaacgcaagcctccttcgaaatggcgggcaagcgtctc
ggcgccgacgtgatgaacatgaacgtcgcgacctcgtcggtcaccaaaggcgaaacgctg
gtcgatacggccgtgacgctcaatgcgatgcgccccgacatcatcgtcgtccgccatcat
gccgccggcgcggtcgagctgttgtcgcaaaaggtcgattgctcggtcatcaacgccggc
gacggcgctcaccagcatccgacccaggccctgctcgacgccctgacgatccgccgcgcc
aagggccgcgtcgccgggctgaccgtcgcgatctgcggcgacatcctgcactcgcgcgtc
gcacgctccaatatcaatgtcctgaacgcgctcggcgcgcaggtgcgcctcgtcgcaccc
tcgacgcttcttccttcgtcgcccgaacggctcgggaccgaggtttacaccgacatgtgg
aaaggcatcgacggcgtcgacgtcgtcatgatgctgcgcctgcagcgcgagcgcatggac
gcatcctacgttccctccagccgcgagttcttccacttcttcgggctcgatcacgagaag
ctcgcgcgcgccaagcccgacgcgctcgtgatgcatcccggcccgatgaatcgcggcgtc
gagatcgcatccacggtcgccgatcattcccgcagcgtgatccgcgaacaggtcgaaatg
ggggttgccgtgcgtatggccgtgctcgaagcgctctcggcgcatctgccaagcttcaag
gacgtcgcctga

DBGET integrated database retrieval system