KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_0741Help
Entry
Hden_0741         CDS       T01265                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(765132..766274)
Genome map
AA seq 380 aa AA seqDB search
MKIKRHLPLAVPICISLTCVLLVGYFSSRPASSEVDFAVPLGLPPLEAHQRPVKNQVELG
RKLFFDRRLAFNNTNSCAMCHIESQGLTSNQSATAIGMEGRSLNRNAPALYNVAYEKSLF
HDGRETDLAQQAWAPLLSPLEMANPSIGNVVDRIRGFADYKGLFEAAFGEHGVSMETIGT
ALASYQRTLLAGNSRFDQWRYGNKADALTENEKHGFEIFTGKGNCSTCHTVGEKSALFTD
GNFYVTGVGYQTAIGAGARVSKVQLAPGEFIEVKHEDMKSFSAPVLNDIGRFAITLDAKD
RWAYKTPGLRNVELTFPYMHDGSLSTLEDVVEFYDKGGYEHDAERVLHPLGLTQKEKSDL
VAFLKSLTTAEDKAKHSPYR
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaagcgacacttacctctcgccgttcccatatgcatctcgctgacgtgcgtt
ctgctggtgggttatttttcatccagacccgcatcaagcgaagtcgacttcgccgttccg
ctcggtcttccgcctctagaagctcaccagcgacctgtaaaaaatcaggttgagctcggc
cggaaactcttcttcgaccggcgccttgcattcaacaacacgaactcctgcgcgatgtgc
cacatcgagagccagggtttgacctccaatcaatccgcaaccgcgatcgggatggagggg
cgcagtctcaatcgtaacgcgcccgcgctctacaatgtcgcctacgaaaaatcgctgttc
cacgatgggcgcgagaccgacctcgcgcagcaggcatgggcgccgctgctgtctccgctc
gagatggccaatccctcgatcggcaatgtcgtcgaccggatcagggggttcgccgactat
aaaggactgttcgaggctgcatttggcgagcacggcgtctccatggagacaatcggcacg
gcgcttgcctcatatcagcgaaccttgctcgcgggcaactcgcgcttcgatcaatggcgg
tacggaaataaagccgacgctttgacggaaaacgaaaagcacggcttcgagatttttacc
ggcaaaggtaattgctcgacctgccatacggtcggcgaaaaatccgcgctcttcaccgat
ggaaacttctacgtcaccggcgtcggctaccagacggcgatcggagccggcgcccgggtg
tcgaaagttcaactcgcgccgggcgagttcattgaagtgaagcatgaggacatgaagtcc
ttctcggctcccgttctcaacgacatcggccggtttgccataacgctcgatgccaaggat
cgctgggcttacaagactccaggattgcgcaacgtggaactgacgttcccgtatatgcac
gacggctctctttcgaccctcgaggatgtcgtggaattctacgacaagggtggctacgag
cacgacgcagaacgcgttttgcatcctctcggactaacgcagaaggaaaagtccgacctg
gtcgcgttcctgaaatcgctcacgacagccgaggataaggcgaagcactccccttatcgc
tga

DBGET integrated database retrieval system