KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_0786Help
Entry
Hden_0786         CDS       T01265                                 

Definition
alpha/beta hydrolase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hden_0786
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hden_0786
   00020 Citrate cycle (TCA cycle)
    Hden_0786
   00620 Pyruvate metabolism
    Hden_0786
Enzymes [BR:hdn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Hden_0786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
817518..818645
Genome map
AA seq 375 aa AA seqDB search
MSDIQPIVMPKWGLAMAEGTLVGWSVGEGSDIQKGDEIAEIETTKITNVFESPVSGVLRR
QITKGGEIVPVGALLAVLAPSTVSDAEIDAFIGAFVVESADDNGSKVVEREAHLDGRNIF
YKFSGSAEDGIPAVLIHGFGGDADNWLFNIESLSASRPVYALDLPGHGKSTKTVVKGDLD
ELADAVIAVLDDAGVAKAHLVGHSLGGAVAFKVLDKAPTRVASVAGVAPAGLGEGVNDAY
IRGFISAEKRKDVKSALQMLVADPEQVSATMIEGIQRYKRLEGVKEAIETIAAKTMPQGR
QAVSFRSLVEKTDKPVLVVWGEKDAIIDPRHSEGVASTVSVVRLPSVGHMPHLEAAKTFN
AQVAKHFENAEAKSR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacattcaaccgattgtcatgccgaaatggggactagccatggcggagggcacg
ctcgtcggctggtccgtcggcgagggctccgacattcaaaaaggcgacgaaatagcagaa
atcgaaacgacgaaaatcacgaacgtgttcgagagtccggtttccggcgttttgcggcgc
cagatcacgaaaggcggcgaaattgttcctgtgggagcgctgttggccgtgctggcgcca
tcgacggttagtgatgccgagatcgatgccttcattggagcttttgtcgtcgaaagcgca
gacgacaacggctccaaagtcgtcgagcgcgaggctcatttggacggccgcaacattttc
tacaagtttagtggaagtgcggaggacggcattcctgccgtcctcatccacggctttgga
ggggatgcggacaattggctcttcaatatcgagtctctttcggcatcccggcccgtctat
gcactcgatctgcctggccacggcaaatcgaccaagacagtcgtaaagggagatctcgat
gaattggctgatgccgtcatcgcggtcctcgacgatgccggagtcgcgaaggcacatctt
gtcggtcactcgcttggcggcgccgtcgccttcaaggtgctcgacaaggccccaacccgc
gtagcgtcggtcgccggcgttgcgcctgccgggctcggcgagggggtcaatgacgcctat
attcgaggttttatctccgccgagaagcgaaaggatgtgaaatccgcattgcaaatgcta
gtcgcggatcccgaacaggtatcggcgacgatgatcgaaggtatccagcgctacaagaga
ctcgaaggggttaaggaagccatcgaaaccatcgccgcaaagacgatgccgcaaggacgg
caagccgtctcgttccgcagtttggtggagaagaccgacaagcccgtgctggtcgtttgg
ggcgaaaaggacgccatcatcgatccgcgacattccgaaggcgtggcgagtacggtgtct
gtcgttcgcctgccgtcggttggccatatgccccacttggaagcggccaagacgttcaat
gcgcaggtagccaaacatttcgaaaatgcggaggctaagtcgcgctaa

DBGET integrated database retrieval system