KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_0869Help
Entry
Hden_0869         CDS       T01265                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Hden_0869
Enzymes [BR:hdn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Hden_0869
Transfer RNA biogenesis [BR:hdn03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Hden_0869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
908682..909581
Genome map
AA seq 299 aa AA seqDB search
MRRGQNSIGVSLQANPEIDFTNPDALIAALLPAVRDAGRVEMAHFQKGVAIEQKADRSPV
TVADREAEAVLLTALSRIAPGVQLVAEEDIAAGATHGYARRFFLIDALDGTRLFIRGKPE
FSINVAYVEDGRAAFGLIFLPPSERLFVTRSDGSAYEARLSLAGDEAFSALNWKKLETRA
PDRNALVAFNSRSTGGASAHLLAELNVHEARPLGSAMKFCLIAAGEGDLYARFGETCEWD
TAAGQAILEAAGGSVTTLDGKPLTYGHFARGFRNPHFVAWGRQPLWRSGDEASPNARGA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcgggcagaattccattggtgtttcattgcaggcgaatccggagatcgatttc
accaaccctgacgcgttgatcgcggcgctgctgccggcggtgcgtgacgcagggcgcgtg
gagatggcgcattttcagaaaggcgtcgcgatcgagcaaaaggcggaccggtcgccggtg
acggttgcggatcgcgaggccgaggccgtgctgctgacggcattatccaggatagcgccg
ggtgttcagctggttgccgaagaagatatcgcggccggggcgacgcatggctacgcgcgg
cggttctttctcatcgatgcgctggacggtacgcgtcttttcattcgcggcaagccggag
ttttcgatcaacgtcgcatacgtggaagacgggcgggcagcgttcgggctgatcttcctg
ccgccgtccgaacgtttgttcgtcacgcggtcggatggcagcgcgtacgaagcgcggctt
tctcttgcgggcgacgaagcattctccgcgctcaactggaaaaagctcgagacgcgtgct
ccggatcgcaatgcgctcgtcgcattcaatagccggtccacgggcggggccagcgcgcac
ctgctcgcggaactcaatgtccacgaggcgcgaccgctcggctcggcgatgaagttctgc
ctgattgcggcgggcgaaggcgatctctatgcgcgcttcggcgagacgtgcgaatgggat
accgcggcggggcaggcgatcctcgaagcagcgggcggctcggtcacgacgctcgacggc
aagccgttgacctacggacattttgcgcgagggtttcgcaatccgcatttcgttgcgtgg
ggccgccagccgctgtggcgcagcggcgacgaggccagcccaaatgcgcgtggcgcatag

DBGET integrated database retrieval system