KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_1246Help
Entry
Hden_1246         CDS       T01265                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1267924..1268580
Genome map
AA seq 218 aa AA seqDB search
MADIALQRKNMVESQIRPSDVTDRRVTAAMSAIPREAFVPARLAKLAYSDEALHVAPGAV
MLPPTVLAKLVQLADINPADSVLVIGGCAGYAAAIVAQIAKSVVALLPDRETATSVTDAC
RSVSIGNVTAVAGGLSEGWKAQAPYDVIIVEGGVETIPDAVKAQLSDGGRLVAIEVEREL
GHAFLLQKTGEFFVRRDAFQTAAPLLTGFESAKPAFVF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcagacatcgctttacaacgcaaaaacatggttgagagccaaattcgcccgagcgac
gtgaccgatcggcgcgtgacggccgcgatgagcgcgattccccgcgaggcgttcgtcccc
gcgagactggcgaagctcgcctatagcgatgaagcgcttcatgtggcgcctggtgccgtg
atgctgccgccgaccgttctcgcgaagctcgtgcaactcgccgacatcaatcccgccgac
tcggtcctcgttatcggcggatgcgccggatacgcagcggcaatcgtcgcgcagattgcg
aaatcggtcgtcgcgttgctgccagatagagagaccgcaacgtctgtcacggatgcttgc
cgcagcgtttccatcggcaacgtcacggcggtcgccggtggactgtcggaagggtggaaa
gctcaggcaccctatgacgtcattatcgtcgagggcggcgtcgaaacaattcccgacgca
gtcaaagcgcagctgtcagatggcggccgtctcgttgcgatcgaagtcgagcgtgagctc
ggccatgcgtttctgctgcagaagacgggcgaatttttcgttcgccgcgacgcgtttcag
acggctgcgccgctgctgacgggctttgaatccgcgaagcctgctttcgttttctag

DBGET integrated database retrieval system