KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_1356Help
Entry
Hden_1356         CDS       T01265                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
hdn00250  Alanine, aspartate and glutamate metabolism
hdn01100  Metabolic pathways
hdn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Hden_1356
Enzymes [BR:hdn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Hden_1356
Peptidases [BR:hdn01002]
 Cysteine Peptidases
  Family C44
   Hden_1356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC NAD_synthase tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: ADJ23168
JGI: Hden_1356
UniProt: D8JX32
Position
1399655..1401595
Genome map
AA seq 646 aa AA seqDB search
MCGIAGIIGRLDDANRAALSRMSGALAHRGPDAEGTWASEPDARNWGALLAHRRLSILDL
SPTGVQPMTDPVTGDVVVFNGEIYNFGELRARLEAEGQTFQSSGDTAVMLRALGLHGPKA
VSWLRGMFAFACWNPRTRRLVLARDPLGIKPLYLARPMHANANWSLAFASELRALLASGL
LENPRLDPSGVASVVANGFVSGPGTIVKDVELAWPGELLEFDTGGGNPRRERFWNMPRGV
GQPAISEPELANVMEEGLKLHLASDVPLAVFLSGGVDSSAMANLARRAAQSSVHTFTLAF
EDQELNEGPIARRISEAIGTDHHEVVLTEADFAASLDAALDSLDQPTFDGLNAYTMSRAI
RSAGYKVAISGTGGDELFGGYRSFRELPLLQKLLRSTAFVPRNWQAGGARLLTQRLGRSA
GGFPGQTRWSKLPDMLRRGGDLIGLYQLAYALFLPELQRDLLAADFAEPLSDGLHPAMRQ
RLDGETQDCSPLTAISIMEQRMFLGERLLRDNDAASMACSLEQRVPLVDQVLLENVSRLP
EAVRFEPLGRKAILRRIGLRGLDPALFDRPKSGFVMPFDRWIRRGLKKAMDETLRDPAAV
AAAGLNPATVERLWQAFLDGSPGIYWSRVWAIYALVQWCHRNRVFR
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtggtatcgctgggattatcggacggctggatgacgcaaatcgcgctgcgctgagc
cgcatgagcggtgcgctcgcgcaccgtggtccagatgcggagggaacgtgggcgtcggag
cctgacgcgcgcaactggggcgctctgctcgcgcatcgtcggctctccattctcgatctt
tcgcctacgggcgtgcagccgatgaccgatcctgtcaccggcgacgtcgtcgtcttcaac
ggcgagatctataacttcggcgaacttcgcgcccgcctcgaggcggaaggccaaacattc
cagtcgtcgggcgatactgcggttatgctgcgggcgctcggtcttcacggacccaaggca
gtcagctggctgcgcggcatgttcgcgtttgcatgttggaatccgaggacgcgccgcctg
gtgctggcgagggatccgctcggcatcaagccgctttatctcgcgcggccgatgcatgcg
aatgcgaattggtcgctcgctttcgcatccgaattgcgcgcgctgctggcgtcgggattg
ctggaaaatcctcgcctcgatccgagtggcgtcgcgagcgttgttgcgaacgggttcgtg
agcggccccggtacgatcgtcaaggatgtcgaactcgcgtggccgggagagcttctggag
ttcgacacagggggcggaaatccccgtcgcgaacgcttctggaatatgccgcgcggtgtt
gggcagccggcgatcagcgagcccgagttggcgaacgtcatggaggaggggctgaagctt
cacctcgcgagcgacgtgccgttggcggtcttcttgtcgggcggcgtcgactcttccgcc
atggccaacttagcgcgacgcgccgcgcagtcttccgtccacactttcacgttggcgttc
gaagatcaggaactgaacgaggggccgatcgcgcgacgcatcagcgaagcgatcggaacc
gatcaccacgaggtcgtgctgacggaagcggacttcgcggcgtctctcgacgccgcgctg
gacagcctcgatcagccgacgttcgatggcctcaacgcttatacgatgtcacgcgcgatc
cgttctgccggatacaaggtggcgatttccggcacgggcggcgatgaactgttcggcggg
tatcgctcgtttcgggaactgccattgctgcagaagttgttgcgatcgaccgcgttcgtt
ccgcgtaattggcaagcggggggcgcgcgattgctgacgcagcggctcggccgttccgcg
ggcggatttccggggcagacgcgctggtcgaagcttcccgatatgcttcgccgaggcggc
gatctgatcgggctctatcagctcgcctatgcgttgttccttccggagcttcaacgcgat
ctgctcgccgccgattttgccgagccgttgagcgacggtctgcatccggcgatgcggcag
cgtctcgatggcgaaactcaggactgctcgccgttgacggcaatcagcatcatggagcag
cgcatgttcctcggcgaacgtctgctgcgggacaatgacgccgcgagcatggcgtgctcg
ctggaacagcgtgttcctcttgtcgatcaagtcctgctcgaaaatgtcagccggttgcct
gaagcggtgcgcttcgagccgctcggacgaaaggccattctgagacgcatcgggctccgc
ggtctcgatccggcactgtttgaccggccgaaaagcggtttcgtcatgcccttcgatcgc
tggatccggcgcgggttgaaaaaggcaatggacgagacgctgcgggatccagccgccgtg
gcggcggcggggctcaatccagctaccgttgagcggttatggcaggcgttcctcgatggt
tcgccgggcatctactggtcgcgcgtgtgggcgatctacgccctcgtgcaatggtgccat
cgcaaccgcgtgtttcgctag

DBGET integrated database retrieval system