KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_1359Help
Entry
Hden_1359         CDS       T01265                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Hden_1359
Enzymes [BR:hdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Hden_1359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1404292..1405392)
Genome map
AA seq 366 aa AA seqDB search
MNVLTIGGAMVDTIVTIASDRIEQMKMLNAESSYLLLEEGIKTEADQISTSTGGGAINAA
VAIARLGNSTSTIVKLGEDSKARTVLDRLTEEGVDLRWIVTDDTAPTGASVIVSSHERNA
AVFTYRGANTKLEAADIPAAAFEKRDLVYVANLSNQSADCYPLIVDRAKSAGAKLAVNPG
VRQLTARYDDFWESLDQIDILSINRSEAQALMPRLLQSFGDGGAPLAVHNGATTPALAKR
GLRNGGYEMSLGKFFGGLIKVGVGTVVLTDGANGAFLATGSDLYFREAPHVVAAATTGAG
DAFSATFACYSSQTNDVARALSAAALNAASVVKFVDTQSGLLTLQALEAEIESAAATAPS
LHSWSI
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtcctcaccatcggcggcgcgatggtcgacaccatcgtcacgatcgcgagcgac
cgcattgagcagatgaaaatgctcaatgccgaaagctcctatctattgctcgaggaaggc
atcaagacggaagccgatcagatttcgacgagcacgggcggtggtgcgatcaacgcggca
gtcgctatcgcgcggctcggaaactcgacatcgacgatcgtcaagcttggtgaggattcg
aaagcgcgcacggtcctcgaccggctgacggaggaaggtgtcgatctgcgctggatcgtg
actgacgatacagccccgaccggcgcctccgtcatcgtttcatcgcacgaacgcaatgcc
gccgtcttcacgtatcgcggtgcgaatacgaaactcgaagctgccgacatcccggcagcc
gcattcgagaagcgcgatctcgtttatgtcgccaacctcagcaatcaatccgccgactgc
tacccgttgatcgtcgatcgcgcgaagtcggcgggcgccaagctcgccgtaaaccccggc
gtgcgccagttgacggcgcggtacgacgatttctgggaaagcctcgatcaaatcgacatc
ctgtcgatcaatcgctcggaagcccaggcgttgatgccccgccttctgcaatcatttggc
gacggcggagcgcctctcgcggtccacaatggagcgacgacgcccgcactggccaagcgc
ggcttgcgcaacggcggctacgaaatgagccttggcaagtttttcggcggactcatcaag
gttggcgtcggaaccgtcgtgctgactgacggcgccaacggagcgttcctcgcgacgggc
agcgatctctattttcgcgaagctccgcacgtcgtcgcggcggcaaccaccggcgcaggc
gatgcgttctcggccacattcgcctgctattcatctcagacgaatgacgtggcgcgcgca
ttgagcgctgcagccctcaacgccgcgagtgtcgtcaagttcgtcgacacgcaatcgggt
cttttgaccttgcaggcactggaagccgaaatcgaaagcgccgcagcgactgcgccgtcg
cttcatagctggtcgatctag

DBGET integrated database retrieval system