KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_1360Help
Entry
Hden_1360         CDS       T01265                                 

Definition
ROK family protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hden_1360
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hden_1360
   00520 Amino sugar and nucleotide sugar metabolism
    Hden_1360
Enzymes [BR:hdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Hden_1360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1405389..1406195)
Genome map
AA seq 268 aa AA seqDB search
MPEIGDKKHVLRQDARSGNPNILSVDIGGTLIKAAVIDQSGALVSEFVTTPTPHPATPDT
IIALIARIAAPLPDFGLISIGFPGVVHRECISTAPNLGTAHWKNFDLEQTLRDTFGAPVR
ILNDAIVYGLGVAKGPGRECVLTFGTGMGCALFSDGTIFCGLELGQHYARDDQNYDQYVG
HAAYLELGLDAWNARAERALQAVHALTNADRIYLGGGNSRRITFALPEWATIVQPSSGVA
GGARLWHADMDRWFAPRQPAMAQARERT
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaaatcggcgacaaaaagcatgtccttcgccaggacgcccgaagcggcaatccc
aacatcttgtcggtcgatatcggtggtacactgatcaaggccgctgtcatcgatcaatcc
ggagcgctcgtttccgagttcgtgacaacgcccacgccgcaccccgcgacgccggatacg
atcatcgcgctcatagcccgcatcgctgcgccgctgccggatttcggattgatttcgatc
ggctttccgggcgtcgtccatcgcgaatgcatttcaacggcgcccaacctcggcaccgct
cactggaagaacttcgaccttgagcagacgctgcgcgacacgttcggtgcaccggtccgg
atattaaacgatgccatcgtctatggcctcggcgtcgcgaaagggccgggccgcgagtgc
gttctgacgttcggcaccggcatgggctgcgcacttttcagcgatggcacgatcttctgc
ggcctggagcttggccagcactacgcacgcgacgatcagaactacgatcaatacgtcggc
cacgctgcctatcttgaactcggcctcgacgcatggaacgcgcgggcggagcgtgccctc
caagccgtgcatgccttgacgaacgcagatcgcatttatctcggaggcggaaactcgcgg
cgcatcacgtttgcgcttccggaatgggcaaccatcgttcaaccgtcatcgggcgtcgcg
ggcggagcgcgcctctggcacgcagacatggatcgctggttcgcgccccgccaaccggcg
atggcgcaagcgcgggaacgcacatga

DBGET integrated database retrieval system