KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_1417Help
Entry
Hden_1417         CDS       T01265                                 

Definition
dihydrofolate reductase
Orthology
K17364  
dihydromethanopterin reductase [EC:1.5.1.47]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Hden_1417
Enzymes [BR:hdn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.47  dihydromethanopterin reductase [NAD(P)+]
     Hden_1417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1470548..1470964)
Genome map
AA seq 138 aa AA seqDB search
MEQTVVRVICAIGQSGQLGHNGVLPWEGNPSPEYVADVARFFDITRGHVLLAGPKTIASV
PKFAFADRTIEVLRSHMDPEQTLKHYAGRVVFIGGGPPVWDIYARYVSHWDVTRLPYDGP
ADRWFNPLWLTCGEHQQR
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
gtggaacagacagtcgtcagggtcatttgcgcaatcggccaatcgggacaactcggccac
aacggcgttttgccgtgggagggtaatccgtcaccggaatacgtcgccgacgtcgcgcgc
ttcttcgacatcacccgaggccacgttctacttgcaggccccaagaccatcgcaagcgtt
ccgaagtttgcattcgcggatcggacgattgaagttctgcgctcgcacatggaccccgag
cagacgctgaaacactacgctggccgcgtcgtcttcatcggcggcggtcctccggtgtgg
gatatctatgcgcgctacgtcagccattgggacgtgacccgcctgccctacgacggcccc
gccgatcgctggttcaatccgctctggctgacgtgcggcgagcaccagcagcgctga

DBGET integrated database retrieval system