KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_1441Help
Entry
Hden_1441         CDS       T01265                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
hdn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hdn01100  Metabolic pathways
hdn01110  Biosynthesis of secondary metabolites
hdn01130  Biosynthesis of antibiotics
hdn01230  Biosynthesis of amino acids
Module
hdn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hden_1441
Enzymes [BR:hdn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Hden_1441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADJ23253
JGI: Hden_1441
UniProt: D8JXB7
Position
complement(1497782..1498585)
Genome map
AA seq 267 aa AA seqDB search
MADILDKITAYKREEVARAKTLKPLRVISEYARSAPRVRPFAGAIEEKLKAKKPALIAEI
KKASPSKGLIRADFDPPTLAKAYEAGGAACLSVLTDTPSFQGAPDFLTAARAATHLPVLR
KDFMIDTYQVAEARAWGADCILIILAEVDDATARDLATAAKDWEMDAIAEVHDAEELDRA
LKLDCRLIGINNRNLKTFEVNLETTERLAPKIPKDRIVVGESGIFTPADIARLAKAHVHT
YLVGESLMRQADVTAATKTLLGGASSQ
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggccgatattctcgacaaaatcaccgcctacaaacgcgaagaagtggcccgcgccaaa
acccttaagcctctgcgcgtcatttccgaatacgcgcgatccgcgccgcgcgtgcgcccg
ttcgcaggcgcgatcgaagaaaagctcaaagccaaaaagcccgcgctgatcgccgaaatc
aaaaaggcgtcgccgtcgaaaggtctgatccgcgccgacttcgatccgccgacgctcgcg
aaggcctatgaagcgggcggcgcggcttgcctttctgtcttgaccgatacgccctcgttc
cagggcgcaccggattttctcaccgctgcgcgcgcggcgacgcatctgccggtgctgcgc
aaggacttcatgatcgacacctatcaggtcgcggaagcacgcgcctggggcgccgattgc
atcctgatcatcctcgcggaagtcgacgacgcaacggcccgcgatctcgcgaccgcggcc
aaggattgggagatggacgccatcgccgaggtgcacgacgcggaagaactcgatcgcgcg
ctgaaactcgattgccgcctgatcggcatcaacaatcgcaacctcaagacgttcgaggtc
aatctcgaaacgacggaacgtctcgcaccgaaaattccgaaggaccgcatcgtcgtcggc
gaaagcggcatcttcacaccggccgacatcgcgcgcctcgcgaaggcgcacgtccacacc
tatctcgtcggcgaaagcctgatgcgccaggccgacgtgacggccgcgacgaaaaccttg
ctcggcggcgcgtcctcgcaatga

DBGET integrated database retrieval system