KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_1448Help
Entry
Hden_1448         CDS       T01265                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hden_1448
   01230 Biosynthesis of amino acids
    Hden_1448
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hden_1448
   00051 Fructose and mannose metabolism
    Hden_1448
   00562 Inositol phosphate metabolism
    Hden_1448
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Hden_1448
Enzymes [BR:hdn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Hden_1448
Exosome [BR:hdn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Hden_1448
  Exosomal proteins of bladder cancer cells
   Hden_1448
  Exosomal proteins of melanoma cells
   Hden_1448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1505151..1505927
Genome map
AA seq 258 aa AA seqDB search
MAGQGHSIRPLVAGNWKMNGLKGSLAEAVGVRDALAGPLASISADVMIAPPATLIAPLAE
ISAGSRLAVAAQDCHAKASGAHTGDVAAEMLKDAGAAAVILGHSERRADHGETNAEVKAK
AAAAHRAGLIAIVCIGETQGERAAGATLKVVSRQLKNSLPEGATAANTVVAYEPVWAIGT
GLTPTPADVEQVHAAIRRDLSEVTGAEGANIRILYGGSVKPDNATELMAIPNVNGALVGG
ASLKASDFLAILRAYEGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcagggcaaggacactctattcggccgctcgttgccggcaactggaagatgaacggt
cttaagggaagcctcgccgaagccgtgggcgttcgggacgcgctcgccggtccgttagcc
tcgatctccgccgatgtcatgatcgccccaccggcaacgctcatcgcgccgctcgctgag
atttcagccggatctcgtctggcggtcgcggcgcaagattgtcatgcgaaagcttcaggc
gcgcataccggtgacgttgcagcggagatgctcaaggacgcgggcgcggcggctgtcatc
ctcggccattcggagcgccgggcggatcacggcgagacgaatgccgaagtcaaagcaaaa
gccgctgccgcgcatcgcgcgggcctgatcgcgatcgtctgtattggggagacgcagggt
gagcgggctgccggggcgacgctaaaagtcgtgtcgcggcaactcaagaattcgctgcct
gagggcgcgaccgccgcgaataccgtcgttgcgtacgaacccgtgtgggcgatcggcacc
gggctgacgccgacgcctgccgacgtcgaacaggtccatgccgccatccggcgcgatctt
tcggaagtcaccggcgcggaaggggcgaacatccgcattctttacggcggctccgtcaaa
ccggataatgctacggagctgatggcgattcccaatgtcaacggcgcgctcgtcggcggg
gcgagtttgaaagccagtgattttctggccatacttcgggcttatgagggccgatga

DBGET integrated database retrieval system