KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_1448Help
Entry
Hden_1448         CDS       T01265                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
hdn00010  Glycolysis / Gluconeogenesis
hdn00051  Fructose and mannose metabolism
hdn00562  Inositol phosphate metabolism
hdn00710  Carbon fixation in photosynthetic organisms
hdn01100  Metabolic pathways
hdn01110  Biosynthesis of secondary metabolites
hdn01120  Microbial metabolism in diverse environments
hdn01130  Biosynthesis of antibiotics
hdn01200  Carbon metabolism
hdn01230  Biosynthesis of amino acids
Module
hdn_M00002  Glycolysis, core module involving three-carbon compounds
hdn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hden_1448
   00051 Fructose and mannose metabolism
    Hden_1448
   00562 Inositol phosphate metabolism
    Hden_1448
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Hden_1448
Enzymes [BR:hdn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Hden_1448
Exosome [BR:hdn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Hden_1448
  Exosomal proteins of bladder cancer cells
   Hden_1448
  Exosomal proteins of melanoma cells
   Hden_1448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADJ23260
JGI: Hden_1448
UniProt: D8JXC4
Position
1505151..1505927
Genome map
AA seq 258 aa AA seqDB search
MAGQGHSIRPLVAGNWKMNGLKGSLAEAVGVRDALAGPLASISADVMIAPPATLIAPLAE
ISAGSRLAVAAQDCHAKASGAHTGDVAAEMLKDAGAAAVILGHSERRADHGETNAEVKAK
AAAAHRAGLIAIVCIGETQGERAAGATLKVVSRQLKNSLPEGATAANTVVAYEPVWAIGT
GLTPTPADVEQVHAAIRRDLSEVTGAEGANIRILYGGSVKPDNATELMAIPNVNGALVGG
ASLKASDFLAILRAYEGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcagggcaaggacactctattcggccgctcgttgccggcaactggaagatgaacggt
cttaagggaagcctcgccgaagccgtgggcgttcgggacgcgctcgccggtccgttagcc
tcgatctccgccgatgtcatgatcgccccaccggcaacgctcatcgcgccgctcgctgag
atttcagccggatctcgtctggcggtcgcggcgcaagattgtcatgcgaaagcttcaggc
gcgcataccggtgacgttgcagcggagatgctcaaggacgcgggcgcggcggctgtcatc
ctcggccattcggagcgccgggcggatcacggcgagacgaatgccgaagtcaaagcaaaa
gccgctgccgcgcatcgcgcgggcctgatcgcgatcgtctgtattggggagacgcagggt
gagcgggctgccggggcgacgctaaaagtcgtgtcgcggcaactcaagaattcgctgcct
gagggcgcgaccgccgcgaataccgtcgttgcgtacgaacccgtgtgggcgatcggcacc
gggctgacgccgacgcctgccgacgtcgaacaggtccatgccgccatccggcgcgatctt
tcggaagtcaccggcgcggaaggggcgaacatccgcattctttacggcggctccgtcaaa
ccggataatgctacggagctgatggcgattcccaatgtcaacggcgcgctcgtcggcggg
gcgagtttgaaagccagtgattttctggccatacttcgggcttatgagggccgatga

DBGET integrated database retrieval system