KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_1482Help
Entry
Hden_1482         CDS       T01265                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Hden_1482
Enzymes [BR:hdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Hden_1482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1533435..1533962
Genome map
AA seq 175 aa AA seqDB search
MPQSHSGPATKVPRNPFDAVLGLGSNIGDRVGNIEDAIARLTADGVIKLVARSRYYRTAP
WGVTDQDWFVNACIAVKADVSARELLARCQAVENGMARVRTQRWGPRNIDVDVLTFRDQK
IVEPDLVVPHPRIAERAFVLVPLKDVAPDIRIDGASIDEMLSRLDASDVQPLAGA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaaagtcattcgggcccagcgacgaaagttccacgcaatccatttgacgctgtg
ctggggctgggttcgaacatcggcgacagggtcggcaatatcgaagatgcgatcgcgcgt
ttgacggcggacggcgtcatcaagctcgttgcgcgttcgcgatattatcgaaccgcgccg
tggggcgtgacggaccaggattggttcgtcaatgcttgtatcgcggttaaagctgacgtt
tcagcgcgagaactgctggcgcgatgtcaggcggtcgaaaacggcatggcgcgtgttcgc
acgcagcgctggggaccgcgcaatatcgacgtcgacgtcctaaccttccgcgaccagaaa
atcgttgagcctgatcttgtcgttccgcatccgcggatcgccgagcgggcgttcgtgctc
gtcccgctcaaggacgtcgctccggacatcaggatcgatggcgcgtcgatcgacgagatg
ttgtcgcgtcttgacgccagcgacgtgcagccgctcgccggggcctga

DBGET integrated database retrieval system