KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_1645Help
Entry
Hden_1645         CDS       T01265                                 

Definition
Malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Hden_1645
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Hden_1645
Enzymes [BR:hdn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Hden_1645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1674486..1675925
Genome map
AA seq 479 aa AA seqDB search
MGERVNVSFFQELMNSIAEQGRALLPKALFGTVGGDSIEVLARALMSGRGEASGVAIARQ
LLLQLKKASTDERLQFYRFLADELQPDAAEVADAARGYLDQPSEKSLARLQSASYSPRME
FFRRLNLAPGATAEIVALRADLLRHLKADEALAAVDRDLQRLLTSWFNRGFLVLRRIDWQ
TPAAILEKIIAYEAVHEIRGWDDLRRRLDPKDRRCFAFFHPALVDEPLIFVEVALMREIP
GTISAVLDAHRDDHDVPPTTAVFYSISNCQEGLKGISFGNFLLKQVVEDLVRDTPSLKTF
VTLSPVPSFARWLDRVLAIDGETGLDPEERATLARLNDPRWVDDVAKGAPGSEELKPVLL
SLAAQYFLAVRSADERPVDPVARFHLGNGARLERVNWLADTSERGLREAHGLMVNYRYDL
GEIERNHEAYAQDGTVAASRGVRALLKSGTQITDLAATSGLLALPSVASAKRARSMGSD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaacgcgtgaacgtctcgtttttccaggagctgatgaactcgattgccgagcag
ggccgggcattgttgccgaaggctctgttcggaaccgtcggcggagactcgatcgaggtt
ctggcgcgggcgctgatgtcgggacgcggcgaagcgtcgggcgtcgcgatcgcgcgacag
cttctgctacaactcaagaaggcgtccaccgacgagcgtctgcagttctaccggttcctc
gcggatgaactccaaccggatgcggcggaggttgccgacgcggcgcgcggctatctcgat
cagccgtcggaaaagagcctcgcgcgtttgcagagcgcttcctacagcccacgcatggag
ttcttccggaggctcaacctcgcgccgggagcgacggcggagatcgtcgcactcagagcc
gatctcttgcggcatctcaaagcggacgaagcgctcgcggcggtcgaccgcgatctgcag
cgcttgctgacgtcgtggttcaatcgcggcttcctggttctgcgccgcatcgactggcag
acgccggcggccattctggaaaaaatcatcgcttacgaagccgtgcacgaaatccgcggc
tgggacgacttgcgccgcaggctcgatccgaaagaccggcggtgcttcgccttcttccac
ccagcgctggtcgatgagcccttgatcttcgtcgaagttgcgttgatgcgtgaaatcccg
ggaacgatctcagccgttctcgatgcgcaccgcgacgaccacgatgtgccgccgacgacg
gccgtcttctactcgatctcgaactgccaggaaggtctcaagggcatctcgttcggcaat
ttcctgctgaagcaggtggtcgaggacctcgttcgtgacactccgagcctcaagacattc
gtgacattgtctccggtgccgagcttcgcgcgctggctcgaccgcgtgcttgcgatcgac
ggcgaaacggggctcgatccggaggagcgcgcaacgctggcgcggctcaacgatccgcgg
tgggtcgatgacgttgccaaaggcgcgccggggagcgaggagctgaagccggtgctgctg
tcgctcgcggcgcagtattttctcgccgtgcgctcggcggacgagcggcccgtagatccc
gtggcgcgctttcatctcggcaatggcgcgcggctcgaacgggtcaactggctcgccgac
acgtccgagcggggcctcagggaagcgcacggcctgatggtcaattaccggtacgacctc
ggcgaaatcgaacgcaaccacgaagcctatgcgcaggacggcacggttgcggcctcgcgc
ggcgtccgcgccttgctcaagtccggcacccaaattacggatcttgcggcgacttccggt
ctgctcgcgctgccgagcgtggcgtcggcaaaacgggcgcgctccatgggctccgattga

DBGET integrated database retrieval system