KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_1786Help
Entry
Hden_1786         CDS       T01265                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Hden_1786
Enzymes [BR:hdn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Hden_1786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1813069..1813680
Genome map
AA seq 203 aa AA seqDB search
MKKLTLPTPVTALSPRRPSRAEAEEAVRTLIAWSGDNPARPGLEKTPERVAEAFGEYFKG
YKQDALAELAQTFEDPSGYNEMVLLKDIAFESHCEHHIAPFFGSAHVAYLPSDRIVGLSK
IARVVDIFARRLQTQESLTEQIATTLEEGLQARGVAIMMSARHHCMAARGVQQRDVATVT
FRFLGEFERNSALRDRFMAVVRD
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctcaccctcccgacgcccgttaccgcgctgtcgccgcgccgcccgtcgcgc
gccgaggccgaagaggccgtgcgcacgttgatcgcctggagcggcgacaatccggcgcgt
ccgggactggagaaaaccccggagcgggtggcggaagcgttcggggaatacttcaaaggc
tacaagcaggacgcgctggcggaacttgcccagacgttcgaggatccgtccggctataac
gaaatggtgctgctgaaggatatcgccttcgagagccattgcgagcaccatatcgcgccc
ttcttcggcagcgcgcatgtcgcctatctgccgtcggaccgcatcgtcggcttgtcgaag
atcgcgcgcgtcgtcgatatctttgcccggcgtctgcagacgcaggaaagtcttaccgaa
cagatcgcgacaacgctcgaggaagggcttcaagcgagaggcgtcgcgatcatgatgagc
gcgcgtcatcactgcatggcggcgcgcggtgttcagcagcgtgacgtggccaccgtcacg
tttcgttttctcggcgagttcgagcgcaattcggcgttacgcgatcgcttcatggcggtg
gtccgcgactag

DBGET integrated database retrieval system