KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_1865Help
Entry
Hden_1865         CDS       T01265                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hden_1865
   00030 Pentose phosphate pathway
    Hden_1865
   00051 Fructose and mannose metabolism
    Hden_1865
   00052 Galactose metabolism
    Hden_1865
   00500 Starch and sucrose metabolism
    Hden_1865
   00520 Amino sugar and nucleotide sugar metabolism
    Hden_1865
  Nucleotide metabolism
   00230 Purine metabolism
    Hden_1865
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hden_1865
Enzymes [BR:hdn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Hden_1865
    5.4.2.8  phosphomannomutase
     Hden_1865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1895775..1897280
Genome map
AA seq 501 aa AA seqDB search
MLPKPRADLKPNTADFERLPLVKPTGFREYDARWLFPEEINLMGLNAVGLGMATLFTRRG
VPRRIVVGHDYRWYSGAVKQALMTGLLAGGCEVHDIGLALSPMAYFAQFELDVEGVAMVT
ASHNDNGWTGIKMGLSRPLTFGPDDMSELKSIVLNGDYETRTGGRYIFVHDMAERYVKSL
TNRPKLKRRLKVVAACGNGTAGAFAAEVLSAVGCEVVPLNTDLDHSFPNHNPNPEDMKML
HAVAAKVRETNADVGLAFDGDGDRCGVVANDGHEIFADKVGVMLARDISSLHRNAKFVVD
VKSTGLFTTDPVLIANGATTTYWKTGHSYIKRFNFENKTLVGFEKSGHFFFNTPLGRGYD
DGLIAALAVCDMLDRNPDKSIADLRDALPKTWSSPTMSPHCDDEKKYDVVERITEHYKRQ
KDSGGHIAGQAIRDLITVNGVRVMLEDGTWGLVRASSNKPELVVVVESPTSEANMKAIFK
DIDQQLSRFPEVGEYNQKIAV
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgaagccacgcgccgacctcaaacccaacacggccgatttcgaacgactgccg
ctcgtcaagccgaccggctttcgcgaatatgacgcgcgctggctgttccccgaagaaatc
aatctgatgggtctcaatgccgtcgggctcggcatggcgacgctgttcacgcggcgcggc
gttccccgtcgtatcgtcgtcgggcatgactaccgctggtattcgggcgcggtgaagcag
gcgctgatgaccggacttctggcaggcggctgcgaagtccacgacatcggtctcgcgctg
tcgccgatggcgtacttcgcgcagttcgaactcgacgtcgaaggcgtggcgatggtcacc
gccagccataacgacaacggctggacgggcatcaagatgggtctgtcgcgaccgttgacg
ttcggccccgacgacatgtcggagctgaaatcaatcgtcctcaacggcgactatgaaacg
cgcaccggcggccgttatatcttcgtgcacgacatggctgaacgctatgtcaaatcgctg
acgaaccgcccgaagctgaagcgtcgtctcaaagtcgtggcggcgtgcggcaacggaacg
gcgggtgcgttcgcggcagaagttctgtcggcggtcggctgcgaggtcgttccgctgaac
acggacctcgatcattccttcccgaaccacaatccgaaccccgaagacatgaagatgctg
cacgcggttgcggccaaggttcgcgaaaccaacgccgacgtcgggctggccttcgatggc
gacggcgatcgctgcggtgtcgtcgcgaacgatgggcatgagattttcgcggacaaggtc
ggcgtcatgctggcccgcgatatctcttcgctccatcgcaacgcgaagttcgtcgtcgac
gtgaaatcgacgggcttgttcacgaccgatcccgtcctcatcgcgaacggcgcgaccacg
acgtattggaaaaccggccacagctacatcaagcgcttcaacttcgagaacaagacgctg
gtcggtttcgagaagtccggccacttcttcttcaacacgccgcttggacgcggctacgac
gacggactcatcgcggcgcttgccgtctgcgatatgctcgaccgcaacccggacaagtcg
attgccgatcttcgcgacgcgctgccgaagacgtggagttcgccgacgatgtcgccgcat
tgcgacgatgaaaagaaatacgacgtcgtcgagcgcatcaccgagcactacaagcgccag
aaggacagcggcggccacatcgcgggtcaggccattcgcgatctgatcaccgtcaacggc
gtgcgcgtgatgctggaagatggcacctggggccttgtccgcgcctcgtcgaacaagccc
gagcttgtcgtcgtcgtcgaaagcccgacgtcggaagccaacatgaaggcgatcttcaag
gacatcgaccagcagctgtcgcgcttcccggaggtcggtgaatacaatcagaagattgct
gtctga

DBGET integrated database retrieval system