KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_1882Help
Entry
Hden_1882         CDS       T01265                                 

Definition
nitrous-oxide reductase (EC:1.7.99.6)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Hden_1882
Enzymes [BR:hdn01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Hden_1882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1914410..1916335)
Genome map
AA seq 641 aa AA seqDB search
MTSKKETKGLTRRDMLGQTSVIAAAGVTGIAGGIGASELVSRANAQAAGGAAHGNINVAP
GDLDEYYVFFSSGQCGELRIVGLPSMRELMRVPVFNRCSATGWGQTNESLKVLTEHLTPE
SREFLKNRGGTYMNGDLHHPHISFTDGTYDGRYAFMNDKANTRVARVRLDVMKCDKIIQL
PNQHTVHGLRVQKYPRTGYVFCNGEDGVPLPNDGKVLNSPKDYYSIFTAVDGDTMKVAWQ
VIVDGNLDNVDADYQGKYAFSTCYNSEGGVTLAEMTAKEQDWLTVFNIKRIEEAVKKGDF
KEMGGVPVIDGRKGSPYTRYIPVSNGPHGINTAPDGIHIIANGKLSPTCTVFDVRKFDDL
FDDKIKPRDTVVAEPELGLGPLHTAYDGKGNCYTTLFIDSQICKWNLDLAKRAYAGEKVN
PIIQKLDVQYQPGHNHTSMGQTKEADGKWLISLNKFSKDRFLNVGPLKPENDQLIDISGD
KMAIVHDGPSFAEPHDATIVHRSKINPVSIWNRADPMFEDAVKQAKADGVDLENDSKVIR
DGKKVRVYMTSTAPTFGLTDFQVKQGDEVTVYVTNIDAVEDLTHGFTIVNYGVAMEVAPQ
ATASVTFTADLAGVHWYYCQWFCHAMHMEMKGRMLVEPHGA
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaagaaagagacgaagggcctgacacggcgcgacatgcttggccagacaagt
gtgattgccgctgcaggtgtaaccggaatcgcaggcggaataggcgcttccgaactcgtg
agccgggcgaacgctcaggccgccggcggcgcggcgcacggcaacatcaatgtcgcgccg
ggagatcttgacgaatactacgtgttcttctccagcggacagtgcggagagctccgcatc
gtcggccttccttcgatgcgtgaactgatgcgcgtaccggtgttcaatcgctgcagcgcg
acaggttggggacaaaccaacgaaagcctcaaggttctgaccgaacatctcacgccggaa
tcgcgtgaatttttgaagaatcgcggcggcacgtacatgaacggcgatcttcaccatccg
catatctcgttcaccgacggcacctacgacggccgctacgccttcatgaacgacaaagcc
aacacccgcgtcgcgcgcgtccgcctggacgtgatgaagtgcgataagatcattcagctg
ccgaaccagcacacggtgcatggcctccgcgtgcagaaatatccgcgcacgggctatgtt
ttctgcaacggcgaagatggcgtgccgcttcccaacgacggcaaggttctcaacagcccg
aaagactactactcgatcttcaccgccgtcgatggcgacacgatgaaggtggcgtggcag
gtcatcgtcgacggcaacctcgacaacgtcgacgccgactatcagggcaagtacgcgttc
tcgacctgctacaattccgagggcggcgtcacgctcgccgaaatgaccgccaaggagcag
gactggctgaccgtcttcaacatcaagcgcatcgaagaagcggtgaagaagggcgacttc
aaggaaatgggcggcgtgccggtcatcgacggccgcaaaggttcgccctacacgcgctac
attccggtctccaacggtccgcacggcatcaacaccgcgccggacggcattcacatcatc
gccaacggcaagctgtcgccgacatgcacggtgttcgacgtgcggaagttcgacgatctg
ttcgacgacaagatcaagccgcgcgataccgtcgtcgccgagcctgaactcggacttgga
ccgctacacaccgcttatgacggcaaaggcaattgctacacgacgctgttcatcgacagc
cagatctgcaagtggaacctggatctcgcaaagcgcgcctacgcgggtgaaaaggtcaat
ccgatcatccagaagctcgatgtgcagtatcagcccggccacaatcacacttccatgggt
caaaccaaggaagccgatggcaaatggctgatctcgctgaacaagttttcgaaggatcgc
ttcctgaacgtcggtccgctgaaaccagaaaacgatcagctcatcgacatctcgggcgac
aagatggccatcgtacacgacggcccgagctttgccgaaccgcacgacgcgaccatcgtt
catcgctccaagatcaatccagtgtcgatctggaatcgcgccgacccgatgttcgaagac
gcggtcaagcaagcgaaggccgatggcgtcgatctggagaacgactcgaaggtgatccgt
gacggcaagaaggttcgcgtctacatgacgtcgaccgctccgacgttcggtttgaccgat
ttccaggtcaagcagggcgacgaggtcaccgtctatgtcacgaacatcgacgctgtcgaa
gacctgacgcacggctttacgatcgtcaactatggcgtcgcgatggaagtcgcgccgcag
gcgaccgcatccgtgaccttcaccgccgatctcgctggcgttcactggtactattgccag
tggttctgccacgcgatgcacatggaaatgaagggccgtatgctcgtcgagcctcacggc
gcttaa

DBGET integrated database retrieval system