KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_1961Help
Entry
Hden_1961         CDS       T01265                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:hdn00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:hdn00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2004444..2005037)
Genome map
AA seq 197 aa AA seqDB search
MGKIWSMIVSLVAMWTAAPSAAPSHPVNGLAYDFEFTGIDGKPMPLSAYRGKALLIVNTA
SFCGYTKQYAGLQDLWSRYEKAGLVVIGVPSNDFGEQEPKSEGEIKTFCQGAFGVTFPLT
SKQHVVGPDAHPFYKWAAEAMGPSGVPNWNFHKYLVGRDGRLLRSFSTKLPPESPEITGI
IEKALAENAASLEAAPN
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagatttggtcgatgatcgtcagcctcgtcgcgatgtggacggccgcgccaagc
gccgcgccatcacatccggtcaatggcctcgcctatgatttcgagtttaccgggatcgac
ggcaagccgatgccgctttcggcgtatcgcggcaaagccctgttgatcgtcaacacggcg
tcgttctgcggctacaccaaacagtacgcgggtctgcaggatctgtggtcgcgatacgag
aaagccgggctcgtcgtcatcggcgttccgtcgaacgatttcggcgagcaggagccgaag
tccgagggcgagatcaagacgttctgccagggcgcattcggcgtgacgtttccgctgacg
tcgaagcagcacgtcgtcggccctgacgcgcaccccttctacaaatgggcggctgaggcg
atggggccgtccggcgtgccgaactggaatttccataagtatctggtcgggcgcgatgga
cgcctgctgcgatcgttctcgaccaagctcccgccggaatcgccggagatcaccggcata
atcgagaaagctctcgcggagaacgcggcctcgctggaagccgcgccgaattga

DBGET integrated database retrieval system