KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_1966Help
Entry
Hden_1966         CDS       T01265                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Brite
Enzymes [BR:hdn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Hden_1966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2007820..2008674
Genome map
AA seq 284 aa AA seqDB search
MATDASFKIKGGKVGILLLHRLCGTPVEMRFVASGLAKQGYTVHCPTLAGHCGSETELKA
TSWTDWYRSAEMALDELRQECDVVIAGGLSAGAVLAVLLAAKNPTKVNGTALLAPTLWLN
GWMIPWYARLFPLVRFKWFANLMSFPHHDPHGIKDERIRDFIQRARVSRGTSETGNPSTP
GGAVFEHRRMVSAVRKLVSYVRQPTLIVHPLEDDYAAMSNATYLRDSLGGPVDLEVLDDC
YHIVTVDRQRHLVVDAIDRFVANLTGVTAEAHSDVRALSTVSAA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagacgcgagtttcaaaatcaagggcggaaaagtcggaattctgctgctgcat
cgcctttgcggaacacccgtcgagatgcgtttcgtcgccagcgggctcgcgaagcaaggc
tatactgttcattgcccgacacttgccggtcactgcggcagcgaaaccgagttgaaagca
acgtcgtggacggactggtaccgcagtgcggagatggcgctcgatgaactccggcaagag
tgcgacgtcgtcatcgccggcggtctgtcggcaggcgccgtgcttgccgttctgctcgcc
gcgaaaaatcctacgaaggtcaatggaactgcgctgctcgcgccgacgctctggctcaac
ggctggatgatcccgtggtatgcgcggctgtttcctctcgttcgcttcaagtggttcgcg
aacctgatgagctttccgcatcacgatccgcacggcatcaaggacgagcgcattcgcgac
ttcattcaacgggcgcgggtgtctcgcggcacctcggaaaccggcaatccgtcaacgccg
ggcggcgcggtgttcgagcaccggagaatggtgagcgcggtgcgcaagctcgtctcttac
gtccgccagccgacgctgatcgttcatccgctcgaagacgattacgccgcgatgagcaac
gcgacctatctccgcgacagcctcggcggcccggtcgatctcgaagtcctcgacgactgc
tatcacatcgtcaccgtcgaccggcagcgccacctggtcgtcgacgcgatcgaccgcttc
gtcgccaacctgaccggcgtcactgccgaagcgcatagcgatgtcagagcgctgagcacg
gtctcggccgcctga

DBGET integrated database retrieval system