KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2058Help
Entry
Hden_2058         CDS       T01265                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
hdn00630  Glyoxylate and dicarboxylate metabolism
hdn01100  Metabolic pathways
hdn01110  Biosynthesis of secondary metabolites
hdn01120  Microbial metabolism in diverse environments
hdn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Hden_2058
Enzymes [BR:hdn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Hden_2058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ADJ23859
JGI: Hden_2058
UniProt: D8JPX5
Position
complement(2107807..2109111)
Genome map
AA seq 434 aa AA seqDB search
MKTSEIVQLGIDAASDRFDGIERPYSVADVMKLRGSVPIRYTLADIASKRLWQLLNAEPY
VHALGAVTGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAGPELARRIN
RTLQRADQIEHMEGKSSVATWFAPIVADAEAGFGGPLNSFEIMKAYIEAGVAAVHFEDQL
ASEKKCGHLGGKVLIPTAAHIRNLVAARLAADVMGVATLIVARTDAESAKLITSDIDERD
REFIVKGERTAEGFYTLRNGVDACIARGLAYAPYADLLWWETSTPNIEHARKFAEAIHAK
YPGKKLAYNCSPSFNWQKKLDPATIAKFQSELGAMGYKFQFVTLAGFHQLNHSMFELAQG
YRDRGMAAYSELQQAEFASEARGYTATRHQREVGTGYFDAVSLAITGGTSSTTAMSASTE
TAQFHDDAVRPAAE
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaagacttcggaaatagtgcagctgggaatcgatgcggcttccgaccggttcgatggg
atcgagcgaccctattccgttgccgacgtcatgaagctgcgcggttcggtgccgatccga
tacacgctcgccgacatcgcctcgaagcgtctttggcaacttctcaatgccgaaccttat
gtgcacgcgctcggcgccgtcaccggcaatcaggcgatgcagatggtccgcgccggattg
aaagccatctatctctccggctggcaggtcgccgctgacgccaacacggcgagcgcgatg
taccccgaccagagcctctatccggcgaacgccggtccggagcttgcgcgccgcatcaat
cgtaccctgcaacgtgccgatcagatcgagcacatggaaggcaagtcgagcgtcgcgacg
tggtttgctccgatcgtcgcggatgcggaagccgggttcggtgggccgctgaacagcttc
gagatcatgaaggcttacatcgaagcgggtgttgccgccgttcacttcgaggatcagctt
gcttcggagaagaagtgcggccacctcggcggcaaggttctaattccgacagcagcgcat
attcgcaatctcgtggctgcgcgacttgccgccgacgtcatgggtgttgcaacgctcatc
gtcgcgcgcaccgacgccgagtcggcgaagctcatcacgtccgatatcgatgagcgcgat
cgcgaattcatcgtcaaaggtgaacgtacggccgaaggcttctacacgttacgcaacgga
gtcgacgcctgcatcgcgcgcggcctcgcctatgcgccgtacgccgacttgctgtggtgg
gaaacatcgacacccaatatcgagcatgcgcgtaaatttgccgaggccattcacgccaag
tatcccggcaaaaaactcgcctacaattgctcgccgtcattcaactggcagaagaagctc
gatcccgcgacgatcgcgaagttccagagcgagcttggcgcgatgggttacaaattccag
ttcgtaacgctcgctggcttccatcagctgaaccacagcatgttcgagcttgcgcaaggg
tatcgcgatcgcggcatggctgcgtactcggaacttcagcaggccgaattcgcgagcgaa
gcgcgcggctataccgcgacgcggcaccagcgcgaagtcggaaccggatatttcgacgcc
gtttctcttgcgattaccggcggaacctcatcgacgacagccatgtcggcatcgaccgag
acagcgcaattccatgacgatgcagtgagaccggcggccgaataa

DBGET integrated database retrieval system