KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2058Help
Entry
Hden_2058         CDS       T01265                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:hdn01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:hdn00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2107807..2109111)
Genome map
AA seq 434 aa AA seqDB search
MKTSEIVQLGIDAASDRFDGIERPYSVADVMKLRGSVPIRYTLADIASKRLWQLLNAEPY
VHALGAVTGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAGPELARRIN
RTLQRADQIEHMEGKSSVATWFAPIVADAEAGFGGPLNSFEIMKAYIEAGVAAVHFEDQL
ASEKKCGHLGGKVLIPTAAHIRNLVAARLAADVMGVATLIVARTDAESAKLITSDIDERD
REFIVKGERTAEGFYTLRNGVDACIARGLAYAPYADLLWWETSTPNIEHARKFAEAIHAK
YPGKKLAYNCSPSFNWQKKLDPATIAKFQSELGAMGYKFQFVTLAGFHQLNHSMFELAQG
YRDRGMAAYSELQQAEFASEARGYTATRHQREVGTGYFDAVSLAITGGTSSTTAMSASTE
TAQFHDDAVRPAAE
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaagacttcggaaatagtgcagctgggaatcgatgcggcttccgaccggttcgatggg
atcgagcgaccctattccgttgccgacgtcatgaagctgcgcggttcggtgccgatccga
tacacgctcgccgacatcgcctcgaagcgtctttggcaacttctcaatgccgaaccttat
gtgcacgcgctcggcgccgtcaccggcaatcaggcgatgcagatggtccgcgccggattg
aaagccatctatctctccggctggcaggtcgccgctgacgccaacacggcgagcgcgatg
taccccgaccagagcctctatccggcgaacgccggtccggagcttgcgcgccgcatcaat
cgtaccctgcaacgtgccgatcagatcgagcacatggaaggcaagtcgagcgtcgcgacg
tggtttgctccgatcgtcgcggatgcggaagccgggttcggtgggccgctgaacagcttc
gagatcatgaaggcttacatcgaagcgggtgttgccgccgttcacttcgaggatcagctt
gcttcggagaagaagtgcggccacctcggcggcaaggttctaattccgacagcagcgcat
attcgcaatctcgtggctgcgcgacttgccgccgacgtcatgggtgttgcaacgctcatc
gtcgcgcgcaccgacgccgagtcggcgaagctcatcacgtccgatatcgatgagcgcgat
cgcgaattcatcgtcaaaggtgaacgtacggccgaaggcttctacacgttacgcaacgga
gtcgacgcctgcatcgcgcgcggcctcgcctatgcgccgtacgccgacttgctgtggtgg
gaaacatcgacacccaatatcgagcatgcgcgtaaatttgccgaggccattcacgccaag
tatcccggcaaaaaactcgcctacaattgctcgccgtcattcaactggcagaagaagctc
gatcccgcgacgatcgcgaagttccagagcgagcttggcgcgatgggttacaaattccag
ttcgtaacgctcgctggcttccatcagctgaaccacagcatgttcgagcttgcgcaaggg
tatcgcgatcgcggcatggctgcgtactcggaacttcagcaggccgaattcgcgagcgaa
gcgcgcggctataccgcgacgcggcaccagcgcgaagtcggaaccggatatttcgacgcc
gtttctcttgcgattaccggcggaacctcatcgacgacagccatgtcggcatcgaccgag
acagcgcaattccatgacgatgcagtgagaccggcggccgaataa

DBGET integrated database retrieval system