KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2133Help
Entry
Hden_2133         CDS       T01265                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Hden_2133
Enzymes [BR:hdn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Hden_2133
Peptidases [BR:hdn01002]
 Cysteine Peptidases
  Family C44
   Hden_2133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2187942..2189981
Genome map
AA seq 679 aa AA seqDB search
MCGIFGIIDLKGRRSVPLSVLKRSADAMQHRGPDEDGYLQRPGVGFASRRLSIVGLADGQ
QPMFNEDKSVSVVFNGEIYDHDDWRRDLTAHGHTLKTHCDTEILPHMWEAHGEDMFEKLN
GQFAVALFDERKQQFILARDRFGICPLYWTRTTRFGNDWLIFGSEIKTLLATGMIEPKPD
RRGIDAVFNFLAVAGPFSCFDGINILQPGTFLKISRGRQGDAAAISEHAYWTMDFPDKGK
EARGQDEKALVNEFESVLYGAVKRRLRADVPVASYLSGGVDSSTVVAMASDILGAPPATF
TVKIRDPKLDETEQAAVISRHLKADPTIVPCGSEEIVSNYQRLLVATEAPVTDTSCTALM
LLAGKVHEKGFKVALTGEGSDEWFAGYPWYKIDRVLEWLGAISGGTIDAAIRRRFFTWLG
CNKDAVAYLDRCAPSAGGAHPFQRFYDLLGASRFRFYSGDMLGELGDHDPYADFAPDLGR
AERWHPINRAIYWAGRIHLPGQLLSLKGDRIAMSQSVEMRYPFLDNNVFDFVAGLDPSWK
IKGLREKYLVRRVAEKWLPKSVAWRPKGMFRAPLDGFFLQQRLPYVDELLSEASLKKTGY
FDPEAVALWRTKYTELSSHFYQRSSMELGLVAVLATQLWHQTFIDSSLANLPDWHTLAGV
ERNPRDLAFAEQLPEAAAV
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattttcggaatcattgatctcaaagggcgccgctcggttcccctctccgtg
ctgaagcgctccgccgatgccatgcagcatcgcggccccgacgaggacggatatctgcag
cggcccggcgtcggcttcgcatcgcgccgcctcagcatcgtcggattggccgatggccaa
cagccgatgttcaacgaggacaaatccgtctcggtcgtcttcaacggcgaaatctatgac
cacgacgactggcgccgcgatctgacggcgcacggtcacacgctcaaaacgcactgcgac
accgaaattcttccgcacatgtgggaagcgcacggcgaagacatgttcgaaaagctcaac
ggtcagtttgccgtcgcgctgttcgacgaacgcaagcagcaattcattctcgcgcgcgac
cgtttcggcatttgtccgctctactggacgcgcacgacgcggttcggcaacgactggctg
atcttcgggtcggagatcaagacgctgctcgcgaccggcatgatcgagccgaagccggat
cggcgcggtatcgatgcggtcttcaattttctcgcggtcgcgggtccgttcagctgcttc
gacggcatcaacatcctgcagcccggcacgttcttgaaaatctcgcgcggccgtcagggc
gatgctgccgcgatcagcgagcatgcgtattggacgatggactttcccgacaaagggaaa
gaagcgcgcggccaagatgagaaggcgctcgtcaatgagttcgagagcgttctgtatggc
gcagtgaagcgtcggctccgcgccgatgttccggttgcgtcgtatctcagcggcggcgtc
gactcgagcacggtcgtcgcgatggcgagcgacattcttggcgcgccgccggcgacgttc
acggtcaagatccgagatccgaaactcgacgagaccgagcaggcggcagtgatctcacgc
catctcaaggccgatccaacgatcgtgccgtgcggctcggaagaaatcgtttcgaactac
caacggctgctggtcgcaacggaagcgcccgtcacggatacgtcgtgcacggcgctgatg
cttcttgcaggcaaagtgcatgaaaagggcttcaaggttgcattgaccggcgaaggttcc
gacgaatggttcgccggctatccgtggtacaagatcgaccgcgtgctcgagtggcttggc
gcgatttcaggcggcacgatcgatgccgccattcgcagacgcttcttcacgtggctcggc
tgtaacaaggacgccgtggcctatctcgaccgctgcgcaccgtcggcgggcggagcgcat
ccgttccagcgcttttacgatctgctcggcgcgtcgcgttttcgtttctatagcggcgac
atgctcggcgagcttggcgatcatgatccgtacgcggatttcgcgcccgacctcggccgg
gccgagcgctggcatccgatcaatcgcgccatctactgggcgggccgcattcatcttccg
ggccagcttctgagcctcaagggcgatcgcatcgcgatgagccagtcggtcgagatgcgc
tatccgttcctcgacaacaacgtgttcgatttcgttgcgggtcttgatccgagttggaag
atcaaaggactgcgagaaaaatatctggtccggcgcgtagcggagaaatggctgccgaag
tcggttgcgtggcggccgaagggcatgttccgcgcgccgctcgatggctttttcctgcag
cagcgtctgccctacgtcgacgaacttctcagcgaagcctcgctgaaaaagaccggatac
ttcgatcccgaggccgtcgcactgtggcgaacgaaatatacggagctgtcgtcgcacttc
tatcagcgaagctcgatggaactcggcctcgtcgcggtgctcgcgacgcagctctggcac
cagacgtttatcgattcctcgctcgcgaacctgcctgattggcatacgctcgcgggcgtc
gagaggaatcctcgcgatctggcgtttgcggaacagctgccggaagcggccgccgtctga

DBGET integrated database retrieval system