KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2180Help
Entry
Hden_2180         CDS       T01265                                 

Definition
cytochrome C class I
Orthology
K08738  
cytochrome c
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Hden_2180
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Hden_2180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2238912..2239283
Genome map
AA seq 123 aa AA seqDB search
MHMVLIAAALVLSAVFSQAAFAADQTSGEQLFNNNCRTCHSWKEGDNRLGPNLHKIVGRK
SGAVEGYAYSQSMKQANLTWDEATLDKFIASPDSVVQSNNMKPFNGITDAATRKHIVEFL
KSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcatatggttttgattgcggccgcgctggttctttcagcggtgttctcgcaagctgcg
ttcgccgccgaccaaacttccggagaacagctgttcaataacaattgccgtacctgtcac
tcgtggaaggaaggcgataaccggctcggaccaaacctgcacaagatcgtcgggcgaaaa
tccggcgcggtcgaaggctacgcctattcgcaatcgatgaagcaggcgaacctcacctgg
gacgaggcaacgctcgacaagttcatcgcgagccccgactccgtcgtgcagagcaacaac
atgaagcccttcaacggcatcaccgacgccgcgacacgcaagcatatcgtcgagtttttg
aagtcgaagtga

DBGET integrated database retrieval system